BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0202 (622 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 25 6.7 SPAC17A5.06 |ptr8||transcription factor TFIIH complex ERCC-3 sub... 25 8.8 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 25.4 bits (53), Expect = 6.7 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 298 ICIESCKMIKSYFE*SIMLGGPT*SLTFLQPTL 396 +C+ +CK +SYF ++ + P L+ ++P L Sbjct: 691 VCVFTCKFAESYFFLTLSIRDPIIVLSTMRPYL 723 >SPAC17A5.06 |ptr8||transcription factor TFIIH complex ERCC-3 subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 804 Score = 25.0 bits (52), Expect = 8.8 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +3 Query: 342 EHYVRWSNLKPHILTTYIRAHK 407 + +++WSN+KP + + HK Sbjct: 384 QQFLQWSNIKPDHIAVFTADHK 405 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,114,759 Number of Sequences: 5004 Number of extensions: 36805 Number of successful extensions: 69 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -