BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0201 (591 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.4 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 4.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.4 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -2 Query: 35 VPNSCSPGIH 6 VP +C+PG+H Sbjct: 1230 VPQNCAPGLH 1239 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +3 Query: 450 LTFT*TQSDPHSILQLQLFSIRKKTRSIKHIVTL 551 LT ++DP I ++ F + +KT+ ++ + L Sbjct: 508 LTINGIKADPEKISAIRNFPVPQKTKHVRAFLGL 541 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,598 Number of Sequences: 336 Number of extensions: 2542 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -