BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0201 (591 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.02c |prp22||ATP-dependent RNA helicase Prp22|Schizosacc... 25 6.2 SPBC8D2.17 |||alpha-1,2-galactosyltransferase|Schizosaccharomyce... 25 8.3 >SPAC10F6.02c |prp22||ATP-dependent RNA helicase Prp22|Schizosaccharomyces pombe|chr 1|||Manual Length = 1168 Score = 25.4 bits (53), Expect = 6.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 501 LFSIRKKTRSIKHIVTLELNTALNGPSQ 584 L RK+T + HI ++LN L+ PS+ Sbjct: 226 LDGFRKRTDGLVHISNIQLNGRLDHPSE 253 >SPBC8D2.17 |||alpha-1,2-galactosyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 351 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 265 ILRSVGFDRVSVSKFSQIKPVSSPTRPHVAGIAP 366 +L+S GFD+ S S + + HVA ++P Sbjct: 233 LLKSAGFDQAERSALSHLLEAHNTILDHVALVSP 266 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,281,115 Number of Sequences: 5004 Number of extensions: 43909 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -