BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0200 (553 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 25 0.58 X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 22 4.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 4.1 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 4.1 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 22 4.1 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 22 4.1 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 5.4 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.58 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 107 CKLFIVIALYRLVTFSSE*RLW 172 C+LF ++ Y FS E +LW Sbjct: 18 CRLFALVPYYNFEKFSLEHQLW 39 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 21.8 bits (44), Expect = 4.1 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 373 RRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 R+ K R +L+KE A+ K++ + EREE + K ++ E + Sbjct: 48 RQIKIWFQNRRMKLKKELRAV-KEINEQARREREEQERHKQQQQEKQ 93 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 92 VSVNWCKLFIVIALYRLVTFSSE*RLWMTRF*E 190 VSV C LF V L+ L+ E + T+F E Sbjct: 302 VSVWKCLLFFVSVLFILLVKEGEVAFFFTQFSE 334 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 92 VSVNWCKLFIVIALYRLVTFSSE*RLWMTRF*E 190 VSV C LF V L+ L+ E + T+F E Sbjct: 302 VSVWKCLLFFVSVLFILLVKEGEVAFFFTQFSE 334 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 92 VSVNWCKLFIVIALYRLVTFSSE*RLWMTRF*E 190 VSV C LF V L+ L+ E + T+F E Sbjct: 302 VSVWKCLLFFVSVLFILLVKEGEVAFFFTQFSE 334 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 92 VSVNWCKLFIVIALYRLVTFSSE*RLWMTRF*E 190 VSV C LF V L+ L+ E + T+F E Sbjct: 302 VSVWKCLLFFVSVLFILLVKEGEVAFFFTQFSE 334 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.8 bits (44), Expect = 4.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -1 Query: 262 HRHFYYPHHQTRHL 221 H + PHHQ +H+ Sbjct: 175 HPQHHQPHHQQQHM 188 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.8 bits (44), Expect = 4.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -1 Query: 262 HRHFYYPHHQTRHL 221 H + PHHQ +H+ Sbjct: 177 HPQHHQPHHQQQHM 190 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 21.8 bits (44), Expect = 4.1 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 373 RRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 R+ K R +L+KE A+ K++ + EREE + K ++ E + Sbjct: 199 RQIKIWFQNRRMKLKKELRAV-KEINEQARREREEQERHKQQQQEKQ 244 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.8 bits (44), Expect = 4.1 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 373 RRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 R+ K R +L+KE A+ K++ + EREE + K ++ E + Sbjct: 258 RQIKIWFQNRRMKLKKELRAV-KEINEQARREREEQERHKQQQQEKQ 303 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 309 RQLGIFYFFIRHISFFIATSTILIIRP 229 ++L YFFI H+S + L + P Sbjct: 70 KKLSRMYFFILHLSIADLITAFLSVLP 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,671 Number of Sequences: 336 Number of extensions: 2114 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -