BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0200 (553 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46216| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 4e-15 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 37 0.010 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 34 0.089 SB_45073| Best HMM Match : ERM (HMM E-Value=0) 33 0.21 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 32 0.36 SB_53413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 31 0.63 SB_51209| Best HMM Match : UBX (HMM E-Value=0.5) 31 0.83 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 31 0.83 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 31 0.83 SB_38330| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) 31 0.83 SB_12456| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 31 0.83 SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_3312| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 31 0.83 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_52824| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_34357| Best HMM Match : UBX (HMM E-Value=0.28) 29 1.9 SB_43472| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_46364| Best HMM Match : DUF22 (HMM E-Value=3.1) 29 2.5 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 2.5 SB_56774| Best HMM Match : DNA_pol_viral_N (HMM E-Value=0.41) 29 2.5 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_23681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_14572| Best HMM Match : ANF_receptor (HMM E-Value=6.7e-18) 29 2.5 SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 29 3.3 SB_48389| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_44729| Best HMM Match : SET (HMM E-Value=0) 29 3.3 SB_18052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 29 3.3 SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) 29 3.3 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 29 3.3 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_7846| Best HMM Match : CoCoA (HMM E-Value=0.00016) 29 3.3 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_27494| Best HMM Match : MFAP1_C (HMM E-Value=0) 28 4.4 SB_19551| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_50825| Best HMM Match : DUF1168 (HMM E-Value=4.1) 28 5.8 SB_49095| Best HMM Match : UBX (HMM E-Value=0.26) 28 5.8 SB_23319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 28 5.8 SB_2574| Best HMM Match : DUF217 (HMM E-Value=0.066) 28 5.8 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_55578| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 5.8 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_2793| Best HMM Match : UBX (HMM E-Value=0.32) 28 5.8 SB_44491| Best HMM Match : Lipase_GDSL (HMM E-Value=4.5e-05) 27 7.7 SB_43947| Best HMM Match : efhand (HMM E-Value=2e-11) 27 7.7 SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_31610| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_10419| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 27 7.7 SB_25185| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_46216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 78.2 bits (184), Expect = 4e-15 Identities = 53/133 (39%), Positives = 75/133 (56%), Gaps = 2/133 (1%) Frame = +1 Query: 160 MTTLDDKILGEKVHNYCXXXXXXXXXXXXXXXXXXXXNMPNKEIKNA-ELPPINSWNGSA 336 MTTLDD++LGEK NY + NA LPP + Sbjct: 1 MTTLDDRLLGEKRQNYVSSSESEGEEEEPAAA----------SVDNAGSLPP--NMRLQT 48 Query: 337 TNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKI-EEIEDE 513 TGPKGVI+D+RR+KQLE E++ E E+E AL+KK +LS +T E+ Q+K++ +E+E E Sbjct: 49 PKTGPKGVIQDFRRYKQLETEHKKEQEEELKALAKKFSLSCQTSLEDEQEKQLMKELEIE 108 Query: 514 FNELIDEEFLQQY 552 ++EFL+QY Sbjct: 109 -----EDEFLKQY 116 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 37.1 bits (82), Expect = 0.010 Identities = 28/85 (32%), Positives = 48/85 (56%) Frame = +1 Query: 283 KEIKNAELPPINSWNGSATNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVK 462 KE + EL S + SAT K + E+ +R E ++ +EK+ L K++ ++ K Sbjct: 294 KEAQQKELQQELSIHKSATEK-LKDLEENEKRLVTSVQELQSLMEKKDRELLKQMEVTKK 352 Query: 463 TEREEAQDKKIEEIEDEFNELIDEE 537 E EEA+ +EE+EDEF+ ++ +E Sbjct: 353 AE-EEARKSVVEEMEDEFSCIVCQE 376 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 33.9 bits (74), Expect = 0.089 Identities = 18/52 (34%), Positives = 34/52 (65%) Frame = +1 Query: 382 KQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 KQ EAE RA+ EKER+ KL + +R++ + +K+E+ + E ++ +++E Sbjct: 966 KQKEAE-RAKKEKERLLQEDKLHEKEEKDRKDKEKRKVEKEKREKDKQVEKE 1016 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 364 EDWRRFKQLEAENRAE-LEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 +D R ++ E + R + LEKE+ KKL + + +E Q +++ E E++ Sbjct: 914 KDKREREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQKERLREKEEK 964 >SB_45073| Best HMM Match : ERM (HMM E-Value=0) Length = 504 Score = 32.7 bits (71), Expect = 0.21 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = +1 Query: 364 EDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEEFL 543 E+ R ++ E + ELEKER + + L K R + Q+ + + +++EF +DE L Sbjct: 329 EEMRAAQEEERRIKEELEKERKLIEQNRELLEK--RVQEQEAETQRLQEEFERALDELRL 386 Query: 544 QQ 549 Q Sbjct: 387 DQ 388 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 32.3 bits (70), Expect = 0.27 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +1 Query: 349 PKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELI 528 P V+E+ ++ E E E E+E ++ + E EE +++K EE E+E E Sbjct: 190 PASVVEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEE 249 Query: 529 DEE 537 +EE Sbjct: 250 EEE 252 >SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 756 Score = 31.9 bits (69), Expect = 0.36 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 5/81 (6%) Frame = +1 Query: 295 NAELPPINSWNGSATNTGPKGVIEDWRRFKQLEAENRAELEK-----ERIALSKKLTLSV 459 N + P + W A + + + + + EN+ +L++ E++ LSKK L Sbjct: 635 NIDTPSLFRWRHQARVERMEEMKREKEKLESKITENKRQLDQLRKQLEQVDLSKKHELLK 694 Query: 460 KTEREEAQDKKIEEIEDEFNE 522 K E E + KK+ + E++F++ Sbjct: 695 KLEDVEKEQKKLRKEEEDFHK 715 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 31.9 bits (69), Expect = 0.36 Identities = 21/76 (27%), Positives = 42/76 (55%) Frame = +1 Query: 283 KEIKNAELPPINSWNGSATNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVK 462 K +K+ + + S+ ++G +E+ R+ +LEAE++ ++E R K+L V+ Sbjct: 1022 KSLKDEFIQVLEQERRSSPDSGMSEALEELRQ--KLEAEHQEDIEATR----KELIEQVE 1075 Query: 463 TEREEAQDKKIEEIED 510 + R+E Q+ +IED Sbjct: 1076 SLRDELQEAATRDIED 1091 >SB_53413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 31.5 bits (68), Expect = 0.47 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 235 QTRHLRCYCSNCVLSLLESC 176 QTRHL CYC C+ E+C Sbjct: 157 QTRHLSCYCEACLAGDYENC 176 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 31.1 bits (67), Expect = 0.63 Identities = 23/81 (28%), Positives = 39/81 (48%) Frame = +1 Query: 307 PPINSWNGSATNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQD 486 PP+N W+ A N +++ +R + E + R LEKER + L K + EE + Sbjct: 549 PPVNVWDLEANNKSKVQSLQEIQRIE--EEKERKTLEKERREAEAR-ALQQKQQEEEERR 605 Query: 487 KKIEEIEDEFNELIDEEFLQQ 549 ++ E + E +EE +Q Sbjct: 606 RQQELLLQRQRE--EEEMRRQ 624 >SB_51209| Best HMM Match : UBX (HMM E-Value=0.5) Length = 272 Score = 30.7 bits (66), Expect = 0.83 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +1 Query: 376 RFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 + KQLE +R + EK+R+ L ++ L T++EE + K+ + DE Sbjct: 51 QLKQLEESSRIDKEKDRLRLEEEQEL---TKQEEIRQKRRRRVLDE 93 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 30.7 bits (66), Expect = 0.83 Identities = 21/79 (26%), Positives = 36/79 (45%) Frame = +1 Query: 274 MPNKEIKNAELPPINSWNGSATNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTL 453 M NK + E N N + N K + R + + E++ E E + LSK+ + Sbjct: 959 MENKHFEQMEELHSNL-NNALENAAKKDKDFEAIRKDKNQLESKLEQVSEELQLSKRRVM 1017 Query: 454 SVKTEREEAQDKKIEEIED 510 ++ E+E+ + EEI D Sbjct: 1018 EIEIEKEQLKSSHGEEISD 1036 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = +1 Query: 382 KQLEA--ENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNE 522 KQLE+ N AELE+ + A+ +LT E+ E+ +KI+E+E++ E Sbjct: 823 KQLESYISNCAELEEAKRAMDNRLT-----EKVESLTEKIKELENDLEE 866 Score = 28.7 bits (61), Expect = 3.3 Identities = 20/85 (23%), Positives = 43/85 (50%) Frame = +1 Query: 283 KEIKNAELPPINSWNGSATNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVK 462 +E +EL + + N+ + ++E+ R K+L+A E+E+ L ++L Sbjct: 123 QEKHESELEELRAQLDKLENSDTESLVEE--RMKELKANYEREVEE----LKERLAKGES 176 Query: 463 TEREEAQDKKIEEIEDEFNELIDEE 537 R+ ++I+EI+D +++ D E Sbjct: 177 DARDSELTERIQEIDDLKSKMADLE 201 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 397 ENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 E + ++E +A + + VK E EE ++++ EE E+E E +EE Sbjct: 502 ERLKDTDEEEVAAAAAAVVVVKKEEEEEEEEEEEEEEEEEEEEEEEE 548 >SB_38330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/48 (31%), Positives = 29/48 (60%) Frame = +1 Query: 394 AENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 A+ +EK ++ LT+++K R E +++++EE E+E E +EE Sbjct: 103 ADLATRVEKRKLYYCN-LTITIKRRRREEEEEEVEEEEEEEEEEEEEE 149 >SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) Length = 1136 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 382 KQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 K+L EKE S ++ L KT+ E ++K+I++IE+E Sbjct: 306 KELSQTKTEVAEKEAAIASLRVDLQNKTKLSEDENKRIQDIEEE 349 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/58 (29%), Positives = 34/58 (58%) Frame = +1 Query: 361 IEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDE 534 +ED K+ N + ++ +A KL+ ++K ERE + K+ EIE+ +N++I++ Sbjct: 409 LEDVLANKEEALRNSQDAHEQTVA---KLSSAIK-ERETSWKKQKAEIEEHYNKIIND 462 >SB_12456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.7 bits (66), Expect = 0.83 Identities = 22/73 (30%), Positives = 35/73 (47%) Frame = +1 Query: 319 SWNGSATNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIE 498 SW + T G + ED K+ E E E E+E ++ + E EE ++++ E Sbjct: 54 SWEHT-TGGGVRSEEEDELLIKEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 112 Query: 499 EIEDEFNELIDEE 537 E E+E E +EE Sbjct: 113 EEEEEEEEEEEEE 125 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 30.7 bits (66), Expect = 0.83 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = +1 Query: 382 KQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEEFLQQ 549 +Q E + R E+EK+R+ KK L E++ K+IEE +D ++ +E+FL++ Sbjct: 112 RQEEEKRRMEIEKQRMESEKKRIL-------ESKQKRIEESKDTIHD--NEKFLEE 158 >SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 30.7 bits (66), Expect = 0.83 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +1 Query: 388 LEAE-NRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 LE E N+ E ERI K+TL+ ++ +E KK +E+ED +L+ +E Sbjct: 156 LEREVNQQNKEIERILSENKVTLADLSKTQENLMKKAKELEDLQQKLLKQE 206 >SB_3312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 769 Score = 30.7 bits (66), Expect = 0.83 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +1 Query: 376 RFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 + KQLE +R + EK+R+ L ++ L T++EE + K+ + DE Sbjct: 244 QLKQLEESSRIDKEKDRLRLEEEQEL---TKQEEIRQKRRRRVLDE 286 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 30.7 bits (66), Expect = 0.83 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = +1 Query: 382 KQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEEFLQQ 549 +Q E + R E+EK+R+ KK L E++ K+IEE +D ++ +E+FL++ Sbjct: 230 RQEEEKRRMEIEKQRMESEKKRIL-------ESKQKRIEESKDTIHD--NEKFLEE 276 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = +1 Query: 376 RFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDE 534 + LE +RAE+ ++ + KK+ S++ E EE +K I E ++ L+ + Sbjct: 947 QISNLEERHRAEIAEQNLEWEKKIA-SIRKESEEMMEKIIIESREKEEALVQD 998 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/54 (27%), Positives = 29/54 (53%) Frame = +1 Query: 373 RRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDE 534 + + + ++ ELE++RI+L + T +REE +EE+E + I+E Sbjct: 1217 KELNEAQQKHSDELEQQRISLQNEFT-----KREEDLKTHLEELEKSHRDTIEE 1265 >SB_52824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 415 EKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 E E+I L+K+ + K E++ A+ KK EEI++ ++ DE+ Sbjct: 122 EYEKIELAKQHLKAEKLEKDLAEGKKPEEIKEVLSDDEDED 162 >SB_34357| Best HMM Match : UBX (HMM E-Value=0.28) Length = 219 Score = 29.5 bits (63), Expect = 1.9 Identities = 18/59 (30%), Positives = 34/59 (57%) Frame = +1 Query: 337 TNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 T+ K + ++ R +QLE +R + EK+R+ L ++ L T++EE + K+ + DE Sbjct: 40 TSEERKAIFKEQR--EQLEESSRIDKEKDRLRLEEEQEL---TKQEEIRQKRRRRVLDE 93 >SB_43472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.5 bits (63), Expect = 1.9 Identities = 18/59 (30%), Positives = 34/59 (57%) Frame = +1 Query: 337 TNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 T+ K + ++ R +QLE +R + EK+R+ L ++ L T++EE + K+ + DE Sbjct: 60 TSEERKAIFKEQR--EQLEESSRIDKEKDRLRLEEEQEL---TKQEEIRQKRRRRVLDE 113 >SB_46364| Best HMM Match : DUF22 (HMM E-Value=3.1) Length = 205 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 376 RFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 + +QLE +R + EK+R+ L ++ L T++EE + K+ + DE Sbjct: 48 QLEQLEESSRIDKEKDRLRLEEEQEL---TKQEEIRQKRRRRVLDE 90 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +1 Query: 364 EDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNE 522 ED R + E EN E EKER +K + E+E+ ++K+ E+ ++ E Sbjct: 609 EDTSRDRNREKENDREREKEREKEKEKEERDKEREKEKEKEKEREKEKERERE 661 >SB_56774| Best HMM Match : DNA_pol_viral_N (HMM E-Value=0.41) Length = 886 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 364 EDWRRFKQLEAENRAELEKER--IALSKKLTLSVKTEREEAQDKKIEEI 504 E + K+ +A AELEKE+ I K+ + ERE + +++EEI Sbjct: 697 EKLAKLKEEQARKEAELEKEKQEILKKKREERRLARERELEKQRRLEEI 745 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/54 (25%), Positives = 34/54 (62%) Frame = +1 Query: 373 RRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDE 534 ++ K+ + E E E+E A++++ +TE+E+ ++++ EE E+E + ++E Sbjct: 60 KKEKKKKEEEEEEEEEETEAVNEEEEKIEETEKEKDEEEENEEEEEEEEDKVEE 113 >SB_23681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 376 RFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 + +QLE +R + EK+R+ L ++ L T++EE + K+ + DE Sbjct: 109 QLEQLEESSRIDKEKDRLRLEEEQEL---TKQEEIRQKRRRRVLDE 151 >SB_14572| Best HMM Match : ANF_receptor (HMM E-Value=6.7e-18) Length = 808 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/52 (28%), Positives = 30/52 (57%) Frame = +1 Query: 379 FKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDE 534 FKQ + ELEKER +K+ L + ++ ++++K++ I +E + + E Sbjct: 28 FKQRSLQKDKELEKER---AKRKDLEQRLKKLQSKEKELNSIREETEQKLRE 76 >SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 29.1 bits (62), Expect = 2.5 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 2/89 (2%) Frame = +1 Query: 277 PNKEIKNAELPPINSWNGSATNTGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLS 456 P K K A P G K + + R+ + EAE +A+L+KE + + Sbjct: 295 PKKHAKEAPKPKA----GMLDEATAKQALAERRKKAREEAERQAKLDKEEERMQNAMEEK 350 Query: 457 VKTEREEAQDKKIEE--IEDEFNELIDEE 537 + +REEA+ E+ E+E E ++E Sbjct: 351 ERHDREEAERLAEEQRMKEEERKEREEQE 379 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = +1 Query: 352 KGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELID 531 + +E+ R + EAE AE ++ + K+ + REEA+ K IE+ E E I+ Sbjct: 344 QNAMEEKERHDREEAERLAEEQRMKEEERKEREEQERIAREEAEKKAIEDEERRKQEEIE 403 Query: 532 EE 537 + Sbjct: 404 RQ 405 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = +1 Query: 364 EDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 E+ RR ++ E E R ++ K A +KL + ER +++++ IE+E L +EE Sbjct: 1264 EELRRLQE-EREYREQMRKIAEARERKLQ-EEEEERRRQEEEQLRAIEEERRRLQEEE 1319 >SB_48389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +1 Query: 388 LEAENRAELEKERIALSKKLTLSVKT--EREEAQDKKIEEIEDEFNELIDEEFLQQ 549 +EA++R LEKE + S +L K E++ +++ +EI+ N+L+DE Q Sbjct: 155 IEAKSRI-LEKELLLKSSQLAFLEKELEEQQRLLEEETKEIDSYSNQLVDENIHTQ 209 >SB_44729| Best HMM Match : SET (HMM E-Value=0) Length = 1112 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +1 Query: 364 EDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEI 504 ED R+FK+ E + ++ + SK T K +E + +KK++ + Sbjct: 283 EDKRKFKKNNKEGKGTIQSKSAKESKVTTKKSKAGKESSVNKKVKAV 329 >SB_18052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 28.7 bits (61), Expect = 3.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 283 KEIKNAELPPINSWNGSATNTGPK 354 +E+ ++LPP+ SWN GP+ Sbjct: 30 REVTESQLPPLRSWNSQQLAWGPE 53 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +1 Query: 376 RFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIE 507 R ++LE R E E +R KK + +R+EA++KK +EIE Sbjct: 295 REEELERIERVE-EMQRKTQEKKRIEEEEQKRKEAEEKKAKEIE 337 >SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) Length = 3397 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 391 EAENRAELEKERIALSKKLTLSVKTEREEAQD-KKIEEIEDEFNELIDEE 537 E E + ++ + +S+ + S + E D + ++E E+EF E +DEE Sbjct: 2554 EGEKKTPPKQTGVPVSEDVVASSRDRTEPLPDFEDVKEPEEEFEEFVDEE 2603 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 391 EAENRAELEKERIALSKKLTLSVKTEREEAQD-KKIEEIEDEFNELIDEE 537 E E + ++ + +S+ + S + E D + ++E E+EF E +DEE Sbjct: 2016 EGEKQTPPKQTGVPVSEDVVASSRDRTEPLPDFEDVKEPEEEFEEFVDEE 2065 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +1 Query: 364 EDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNE 522 E R KQ E E + + E+ +K L K ++EE + KK EEI + E Sbjct: 351 EQERLEKQAEKEKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEE 403 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/49 (32%), Positives = 33/49 (67%) Frame = +1 Query: 388 LEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDE 534 +E N+ +L + + ++T ++ ++++A D+KIEE EDE +EL+D+ Sbjct: 1783 MEHRNK-QLRDDVVNFQSRIT-ELEHKKKKA-DEKIEEQEDEIHELLDK 1828 >SB_7846| Best HMM Match : CoCoA (HMM E-Value=0.00016) Length = 1284 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 397 ENRAELEKERIALSKKL-TLSVKTEREEAQDKKIEEIEDEFNELI 528 E++ E I L +K L + R+E +KKIEE+E NEL+ Sbjct: 574 ESKKESRALSICLEEKTRNLHEEKRRKEELEKKIEEMETSKNELL 618 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 328 GSATNTGPKGVIEDWRRFKQLEAENRAELEKERIA 432 G +GPK VIE +R K+L + +EK+R A Sbjct: 414 GEPALSGPKAVIERAKRLKRLLEQEVVYVEKQRAA 448 >SB_27494| Best HMM Match : MFAP1_C (HMM E-Value=0) Length = 808 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/63 (22%), Positives = 34/63 (53%) Frame = +1 Query: 361 IEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEEF 540 IE R+ +L+A+ + E EK+ + L ++ + E E ++ ++ + E+E + F Sbjct: 201 IERRRQMLRLKAQQKKEAEKDLLDLEDEVKSEEEEEEESSEYEEYSDSEEETGPRLKPVF 260 Query: 541 LQQ 549 +++ Sbjct: 261 VRR 263 >SB_19551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 331 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/52 (25%), Positives = 34/52 (65%) Frame = +1 Query: 358 VIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 ++++ R+ + LE + ++EK+R+A ++ + + ERE +++++E+ DE Sbjct: 126 LLQEARKLRFLENQ---KIEKQRLAREREEEEAKEEERETTEEEEVEKPSDE 174 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 28.3 bits (60), Expect = 4.4 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Frame = +1 Query: 340 NTGPKGVIED-WRRFKQLEAENR-AELEKERIALS--KKLTLSVKTEREEAQDKKIEEIE 507 +T K V++ W R ++ N +E EK +I K+ L +K +REE + K++EE++ Sbjct: 321 STPAKQVVKTKWDRIREKHQWNLLSEDEKNKIKAERRKQKRLELKVKREEKERKRLEELK 380 >SB_50825| Best HMM Match : DUF1168 (HMM E-Value=4.1) Length = 543 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 391 EAENRAELEKERIALSKKLTLSVKTEREEAQD-KKIEEIEDEFNELIDEE 537 E E + ++ + +S+ + S + E D + ++E E+EF E +DEE Sbjct: 73 EEEKQTPPKQTGVPVSEDVVASSRDRTEPLPDFEDVKEPEEEFEEFVDEE 122 >SB_49095| Best HMM Match : UBX (HMM E-Value=0.26) Length = 267 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/46 (30%), Positives = 28/46 (60%) Frame = +1 Query: 376 RFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 + +QLE +R + EK+R+ L ++ + T++EE + K+ + DE Sbjct: 71 QLEQLEESSRIDKEKDRLRLEEEQEV---TKQEEIRQKRRRRVLDE 113 >SB_23319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 364 EDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKI 495 E W+R +Q + E R +E+E A K+L+ K + EA D+ + Sbjct: 25 ERWQRKEQRQKEERERVERE--AKKKELSAKFKRDYGEAIDEAV 66 >SB_19393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1660 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +1 Query: 391 EAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDE 534 E E R +K+ + K L VK E + KK++++ FN + + Sbjct: 1178 EEEKRKVRKKKLVEFKNKHGLDVKKMDESEKRKKVQQVMSMFNSTVSQ 1225 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +1 Query: 397 ENRAELEKERIALS--KKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 +N+ + E+ R S KKL S+K + EE KK++ E E ++ID E Sbjct: 997 QNQLDYERSRDTKSQVKKLETSIKNDEEEI--KKLKAEEKEHLKVIDTE 1043 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 27.9 bits (59), Expect = 5.8 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +1 Query: 361 IEDWRRFKQLEAEN-RAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELI 528 +E+ + +L+ EN R E+EK+R+ +K+ + ++ EE + K++ I E +E I Sbjct: 1087 LEESNQRSRLDIENVRTEMEKQRLCEVEKVRNEMLSDLEETR-AKLQRIVKECDERI 1142 >SB_2574| Best HMM Match : DUF217 (HMM E-Value=0.066) Length = 225 Score = 27.9 bits (59), Expect = 5.8 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = +1 Query: 385 QLEAENRA---ELEKERIALSKKLTL-SVKTEREEAQDKKIEEIEDEFNEL 525 +LE EN EL K R+ K L S++ + E +D KIEE+E E ++L Sbjct: 1 ELEEENEVLNQELGKLRVQHQKTLDRGSIEEDLTEWKDHKIEELELEVSKL 51 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 27.9 bits (59), Expect = 5.8 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +1 Query: 364 EDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNE 522 E ++ KQLE E + LE+ERI + + ERE+ + +K ++++ E E Sbjct: 155 EKEKQRKQLEVEKQKRLEEERIRSQNE--ERKRREREQKEREKQQKLDMEKEE 205 >SB_55578| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 333 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/72 (26%), Positives = 33/72 (45%) Frame = -2 Query: 354 FRSSIRGRPVPTIDGRQLGIFYFFIRHISFFIATSTILIIRPVIFAATAVIVYFLS*NLV 175 + S+ G V GR F +F+ + FF + ++I+ VIF + V + N + Sbjct: 152 YAMSVGGARVTDWPGRS---FLYFVSVVCFFFPLTIVIIMYIVIFVVVRIQVKRIGKNSI 208 Query: 174 IQSRHSELNVTK 139 + R SE+ K Sbjct: 209 V--RASEMKAAK 218 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 397 ENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 E AE+ ++ + + +TE+E+ +++KIEE E E E +EE Sbjct: 60 EEEAEVGEKTLEAENEEEKIEETEKEKDEEEKIEEEEKEGGEEENEE 106 >SB_2793| Best HMM Match : UBX (HMM E-Value=0.32) Length = 311 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/46 (30%), Positives = 28/46 (60%) Frame = +1 Query: 376 RFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDE 513 + +QLE ++ + EK+R+ L ++ L T++EE + K+ + DE Sbjct: 71 QLEQLEESSKIDKEKDRLRLEEEQEL---TKQEEIRQKRRRRVLDE 113 >SB_44491| Best HMM Match : Lipase_GDSL (HMM E-Value=4.5e-05) Length = 720 Score = 27.5 bits (58), Expect = 7.7 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +1 Query: 280 NKEIKNAELPPINSWN-GSATNTGP----KGVIEDWRRFKQLEAENRAELEKERIALSKK 444 NK +K L N+ N G A +T P KGV+E ++ ++ + RA K+ SKK Sbjct: 199 NKLLKVLSLANGNAGNIGKANSTSPVKGLKGVLEKIKQARKASKKKRARARKKHNKTSKK 258 >SB_43947| Best HMM Match : efhand (HMM E-Value=2e-11) Length = 482 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +1 Query: 409 ELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 ELEK+R+ KL K E Q++++ E ++E N+L +EE Sbjct: 284 ELEKQRLEAQSKLDDFDK----EQQEEELGEAKEELNKLREEE 322 >SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +1 Query: 373 RRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 R ++ E ++R E+ERIA + L + ERE ++++ E E +EE Sbjct: 590 RDAREKERQDRIRRERERIARERALERERERERERERERRRLEYMREQRRRQEEE 644 >SB_31610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 379 FKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELIDEE 537 F+Q E E E+E ++ + E EE ++++ EE E+E E +EE Sbjct: 8 FEQFHVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEGEEE 60 >SB_10419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 27.5 bits (58), Expect = 7.7 Identities = 19/64 (29%), Positives = 36/64 (56%) Frame = +1 Query: 343 TGPKGVIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNE 522 T K ++ R ++ E+ E E+E L++K++ ++K + + +K EE+E E +E Sbjct: 421 TEEKETSDENARRSSVKDEDTDEKERELELLNEKIS-NLKVQHS-VETRKREELEYELSE 478 Query: 523 LIDE 534 LI E Sbjct: 479 LIRE 482 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 457 VKTEREEAQDKKIEEIEDEFNELIDEEFLQQ 549 V E+ + E IE+E N+L+D++F+Q+ Sbjct: 886 VSAEKTFQKKGCFEVIEEEINKLVDQKFIQE 916 >SB_25185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 394 AENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIE 507 AEN E++ E + T KTE + ++ K EE+E Sbjct: 35 AENEKEVKGEEAKTEEAKTEEAKTEEAKREEAKREEVE 72 >SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +1 Query: 358 VIEDWRRFKQLEAENRAELEKERIALSKKLTLSVKTEREEAQDKKIEEIEDEFNELID 531 ++ R + + E EKER A K T S + ERE + K+ E E + L++ Sbjct: 176 LLRQTRSAENVHVEEATSNEKEREATEVKETGSNEKEREATEVKETESNEGSGDALVE 233 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,453,300 Number of Sequences: 59808 Number of extensions: 238874 Number of successful extensions: 1323 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1150 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -