BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0199 (524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKL... 34 0.051 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 31 0.63 At4g31900.1 68417.m04533 chromatin remodeling factor, putative s... 30 0.83 At1g14250.1 68414.m01687 nucleoside phosphatase family protein /... 30 0.83 At1g14230.1 68414.m01684 nucleoside phosphatase family protein /... 29 1.4 At5g28650.1 68418.m03508 WRKY family transcription factor DNA-bi... 28 3.3 At3g47900.1 68416.m05223 ubiquitin carboxyl-terminal hydrolase f... 28 3.3 At4g09450.1 68417.m01555 myb family transcription factor contain... 28 4.4 At4g32260.1 68417.m04590 ATP synthase family contains Pfam profi... 27 5.8 At4g27720.1 68417.m03984 expressed protein contains Pfam PF05631... 27 5.8 At1g64650.1 68414.m07329 expressed protein 27 5.8 At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM dom... 27 5.8 At5g17900.1 68418.m02099 expressed protein 27 7.7 At3g49310.1 68416.m05391 expressed protein contains PF05631: Pro... 27 7.7 At1g72900.1 68414.m08432 disease resistance protein (TIR-NBS cla... 27 7.7 >At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKLE) identical to chromatin remodeling factor CHD3 [Arabidopsis thaliana] GI:6478518 Length = 1384 Score = 34.3 bits (75), Expect = 0.051 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 498 VRY-AKKVFANEEDAKRTKGKVKYDDPDVERVRRAHLNDLENIPV 367 +RY +K++FA+E+D GK+ YDD ++++ L + E + V Sbjct: 761 IRYGSKELFASEDDEAGKSGKIHYDDAAIDKLLDRDLVEAEEVSV 805 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 30.7 bits (66), Expect = 0.63 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 474 ANEEDAKRTKGKVKYDDPDVERVRRAHLNDLENI 373 AN E AK+TKG+ ++ D +R RR D E++ Sbjct: 47 ANGESAKKTKGRGFREEKDSDRQRRLSSRDFESL 80 >At4g31900.1 68417.m04533 chromatin remodeling factor, putative strong similarity to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1202 Score = 30.3 bits (65), Expect = 0.83 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = -3 Query: 498 VRY-AKKVFANEEDAKRTKGKVKYDDPDVER-VRRAHLNDLE 379 ++Y +K++F+ E D GK+ YDD +E+ + R H++ +E Sbjct: 687 IKYGSKELFSEENDEAGRSGKIHYDDAAIEQLLDRNHVDAVE 728 >At1g14250.1 68414.m01687 nucleoside phosphatase family protein / GDA1/CD39 family protein low similarity to SP|P97687 Ectonucleoside triphosphate diphosphohydrolase 1 (EC 3.6.1.5) (Ecto-apyrase) {Rattus norvegicus}; contains Pfam profile PF01150: GDA1/CD39 (nucleoside phosphatase) family Length = 488 Score = 30.3 bits (65), Expect = 0.83 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 Query: 420 DVERVRRAHLNDLENIPVFWVLGALYLTT 334 D ER++ A ENIP+ W LGA L T Sbjct: 442 DDERIKYASKAGKENIPLDWALGAFILNT 470 >At1g14230.1 68414.m01684 nucleoside phosphatase family protein / GDA1/CD39 family protein low similarity to SP|P49961 Ectonucleoside triphosphate diphosphohydrolase 1 (EC 3.6.1.5) (Ecto-apyrase) {Homo sapiens}; contains Pfam profile PF01150: GDA1/CD39 (nucleoside phosphatase) family Length = 503 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 420 DVERVRRAHLNDLENIPVFWVLGALYLTTA 331 D ER++ A E+IP+ W LGA L TA Sbjct: 450 DDERIKYASKAGEEDIPLDWALGAFILNTA 479 >At5g28650.1 68418.m03508 WRKY family transcription factor DNA-binding protein WRKY3, parsley, PIR:S72445 Length = 330 Score = 28.3 bits (60), Expect = 3.3 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 295 HSKQQSCPGSLRCCCKIEC 351 HS++ SC GSL+C K +C Sbjct: 216 HSRRTSCSGSLKCGSKSKC 234 >At3g47900.1 68416.m05223 ubiquitin carboxyl-terminal hydrolase family protein contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 367 Score = 28.3 bits (60), Expect = 3.3 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +1 Query: 196 SNYERNTKGDASRRLR*WFYCVHNSVKYSSSC--VHSKQQSCPGSLRC 333 S ++ DAS L F C+H S SSS V S +C GS C Sbjct: 121 SFFQEAQMNDASEVLAVIFDCLHRSFAQSSSVSDVDSSDSNCTGSWDC 168 >At4g09450.1 68417.m01555 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 200 Score = 27.9 bits (59), Expect = 4.4 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 286 WTNTSHYCVRSKTITSTGARHRLWYS 209 W N S YCV+S+T T + + +++ Sbjct: 113 WKNISRYCVKSRTSTQVASHAQKYFA 138 >At4g32260.1 68417.m04590 ATP synthase family contains Pfam profile: PF00430 ATP synthase B/B' CF(0); identical to cDNA chloroplast ATP synthase beta chain precursor (atpG) GI:5730140 Length = 219 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 288 LCTLETAELPRQPQVLL*DRVPQAPKTLECSRDRSSERVSL 410 L +L + + P + Q+ ++PQ PK+L S D S+ +SL Sbjct: 13 LISLSSNQQPNRVQIPKFAKLPQIPKSLTSSTDLRSKALSL 53 >At4g27720.1 68417.m03984 expressed protein contains Pfam PF05631: Protein of unknown function (DUF791) Length = 460 Score = 27.5 bits (58), Expect = 5.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 143 YCYKAVIKCVTTLKPMYTVIMKG 211 YC ++ C+T P Y V+M G Sbjct: 108 YCITYILSCITKHSPQYKVLMVG 130 >At1g64650.1 68414.m07329 expressed protein Length = 462 Score = 27.5 bits (58), Expect = 5.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 143 YCYKAVIKCVTTLKPMYTVIMKG 211 YC ++ C+T P Y V+M G Sbjct: 108 YCITYILSCITKHSPQYKVLMVG 130 >At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM domain-containing protein contains Pfam profiles PF00168: C2 domain; contains PF02893: GRAM domain; similar to Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length(GI:6980525); similar to Synaptotagmin III (SytIII) (Swiss-Prot:P40748) [Rattus norvegicus] Length = 1859 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 386 ISRTFQCFGCLGHSILQQHLRLPGQLCCFECTQLDE 279 + R +C CL + L Q+ CF+C QL E Sbjct: 762 VKRERECVMCLSEEMSVIFLPCAHQVLCFKCNQLHE 797 >At5g17900.1 68418.m02099 expressed protein Length = 435 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = -3 Query: 501 RVRYAKKVFANEEDAKRTKGKVKYDDPDVERVRRAHLND 385 R+R A+ ++ EE+++ + + + DD D RR + + Sbjct: 96 RIRQAEIIYTEEEESRNQENRDEDDDEDALEERRRRIRE 134 >At3g49310.1 68416.m05391 expressed protein contains PF05631: Protein of unknown function (DUF791) Length = 460 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 143 YCYKAVIKCVTTLKPMYTVIMKG 211 YC ++ C+T P Y V+M G Sbjct: 108 YCIVYILSCITKHSPQYKVLMVG 130 >At1g72900.1 68414.m08432 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 363 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 172 NYFETHVHSNYERNTKGDASRR 237 NYFE+H+H + N +G+ S + Sbjct: 251 NYFESHLHKEFLDNIQGENSSK 272 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,837,765 Number of Sequences: 28952 Number of extensions: 222792 Number of successful extensions: 711 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -