BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0196 (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 28 0.85 SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 28 1.1 SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 27 1.5 SPBC17A3.10 |pas4||peroxisomal ubiquitin-protein ligase E3 |Schi... 26 3.4 SPCC306.06c |||ER membrane protein, BIG1 family |Schizosaccharom... 26 4.5 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 26 4.5 SPBC21B10.11 |dpm2||dolichol-phosphate mannosyltransferase subun... 25 6.0 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 28.3 bits (60), Expect = 0.85 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 118 LDGATCVCQLVTSIDRCRCNDNTNLLFRW 204 LD ++ CQ + DR R + ++ LFRW Sbjct: 776 LDESSVTCQKINDKDRVRFSGQSSSLFRW 804 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 27.9 bits (59), Expect = 1.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 94 RAHSITA*LITSYLYHHVPNNRLGYST 14 R H I+ I LYH VP+ + GY T Sbjct: 647 REHLISRTQIQELLYHQVPSEKAGYHT 673 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 27.5 bits (58), Expect = 1.5 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 349 GGRAHSPPGVKWLLKPIDIYN 287 GG H P V WLL+P DIY+ Sbjct: 235 GGPLHDPNTVMWLLRP-DIYS 254 >SPBC17A3.10 |pas4||peroxisomal ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 306 Score = 26.2 bits (55), Expect = 3.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 386 EIGFKFFFNCLNGWTS 339 E G F ++C+NGWTS Sbjct: 270 ECGHIFCWSCINGWTS 285 >SPCC306.06c |||ER membrane protein, BIG1 family |Schizosaccharomyces pombe|chr 3|||Manual Length = 311 Score = 25.8 bits (54), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 56 IRCN*LSSYRVSPHSFTRPRR 118 I C LSS ++S H+F PRR Sbjct: 288 ISCRLLSSIQISYHAFDSPRR 308 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 25.8 bits (54), Expect = 4.5 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = -2 Query: 233 NLSRTTHRYRHRNNKFVLSLQRHLSIEVTS*HTHVAPSSAWVA*NCEGSLYNCLVNYILS 54 NL++T+ R H + + + S V S T + P + W G LY+C + +LS Sbjct: 1058 NLTQTSQRMFH--DALISGFFKIFSAAVVS-ATLLIPFALWAKNVFGGLLYSCNDDNVLS 1114 Query: 53 LSPC 42 S C Sbjct: 1115 ASQC 1118 >SPBC21B10.11 |dpm2||dolichol-phosphate mannosyltransferase subunit 2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 72 Score = 25.4 bits (53), Expect = 6.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 155 LSIDVAVMIIQICYFGGGICVLSVKDFLRT*DL 253 ++I VAVM+ IC G + +L +K + DL Sbjct: 40 ITIPVAVMLFGICLIGTFVSLLMIKSSKKKSDL 72 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,453,865 Number of Sequences: 5004 Number of extensions: 51163 Number of successful extensions: 114 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -