BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0196 (576 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 2.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 3.8 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 6.6 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +1 Query: 139 CQLVTSIDRCRCNDNTNLLFRWRYL 213 CQ VT I ++ +++ W+Y+ Sbjct: 14 CQGVTDIHSRNLTNSLKVIYEWKYI 38 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 401 RVGSLRRPSGGNS 439 RVGS RRPS NS Sbjct: 397 RVGSTRRPSRRNS 409 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = +1 Query: 130 TCVCQLVTSIDRCRCNDNTNLLFRWRYLCVVRER 231 +C+C + D+T + W+Y+ +V +R Sbjct: 487 SCICVRFIAEHTKMLEDSTKVKEDWKYVAMVLDR 520 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = +1 Query: 130 TCVCQLVTSIDRCRCNDNTNLLFRWRYLCVVRER 231 +C+C + D+T + W+Y+ +V +R Sbjct: 487 SCICVRFIAEHTKMLEDSTKVKEDWKYVAMVLDR 520 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 6.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 433 TAAGTPEGPNSPVQSVK*GSS 371 TAA TP P+ PV S G++ Sbjct: 47 TAAATPTPPSVPVGSAVAGTA 67 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,553 Number of Sequences: 438 Number of extensions: 3497 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -