BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0195 (485 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 23 1.9 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 23 1.9 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 23 1.9 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 4.5 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 22.6 bits (46), Expect = 1.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 11 RENVSVFV*FLQFPRGK*REKWLTVVSREISPSSLA 118 R+ + +F+ +Q K K TVV+RE+ +S+A Sbjct: 331 RKEIDIFLVAIQMNPPKVSLKGYTVVNRELVTASVA 366 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 22.6 bits (46), Expect = 1.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 11 RENVSVFV*FLQFPRGK*REKWLTVVSREISPSSLA 118 R+ + +F+ +Q K K TVV+RE+ +S+A Sbjct: 331 RKEIDIFLVAIQMNPPKVSLKGYTVVNRELVTASVA 366 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 22.6 bits (46), Expect = 1.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 11 RENVSVFV*FLQFPRGK*REKWLTVVSREISPSSLA 118 R+ + +F+ +Q K K TVV+RE+ +S+A Sbjct: 331 RKEIDIFLVAIQMNPPKVSLKGYTVVNRELVTASVA 366 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 394 YTPEEIVVKTVDNKLLVHAKHEEKSDT 474 YTP+ + +N + KHE++++T Sbjct: 2 YTPKLSQMDISENSTYLFDKHEDRNNT 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,566 Number of Sequences: 336 Number of extensions: 1580 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -