BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0194 (504 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 31 0.006 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 6.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 6.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.3 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 31.1 bits (67), Expect = 0.006 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 116 NRKCFREGESRRAPSAGPMLPVAAVTRRTSRTV 214 N +C + S APS PM+P VT TSR + Sbjct: 2281 NTECHPDASSTMAPSTTPMVPDKPVTTTTSRPI 2313 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 284 ELLAVLNSSGA 252 ELLA+L SSGA Sbjct: 105 ELLAILGSSGA 115 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 284 ELLAVLNSSGA 252 ELLA+L SSGA Sbjct: 105 ELLAILGSSGA 115 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 6.3 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = -1 Query: 90 PRCPSGTPSMSPQ----KGSPASQP 28 PRCPSG +S + +G P P Sbjct: 96 PRCPSGESMLSERAALLRGVPTLSP 120 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 20.6 bits (41), Expect = 8.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 317 GNIGPLKTSATELLAVLNSSG 255 GNI PL TSA + L G Sbjct: 50 GNIPPLYTSAENIFKQLREWG 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,355 Number of Sequences: 336 Number of extensions: 2567 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -