BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0194 (504 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces ... 26 3.7 SPAC212.08c |||GPI anchored protein |Schizosaccharomyces pombe|c... 25 6.5 SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyce... 25 8.5 SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosa... 25 8.5 >SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 390 Score = 25.8 bits (54), Expect = 3.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 170 WVQRMALSCSRLHGNTSCLFVLSL 99 W+ +AL+ SR +GNT L L L Sbjct: 189 WMDSVALNLSRYYGNTEALSSLPL 212 >SPAC212.08c |||GPI anchored protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 278 Score = 25.0 bits (52), Expect = 6.5 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -2 Query: 401 MSFSTTRTHPKAIKQKFRMWKQIKLNHLGNI 309 + F ++P A K + ++W+ + +N GNI Sbjct: 234 LGFWLASSYPNAYKWETQLWRTVGINLNGNI 264 >SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 24.6 bits (51), Expect = 8.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 160 GWRSPALAFTETLPV 116 GW+SP+LA TLP+ Sbjct: 30 GWKSPSLAEPFTLPI 44 >SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosaccharomyces pombe|chr 1|||Manual Length = 875 Score = 24.6 bits (51), Expect = 8.5 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 444 VLKGSNYIMGTARIDVVFNHSNASESDQTKVQNVETN*IKSPRKHR 307 V KG + + GT + +H N S S + + + +KSP+ R Sbjct: 446 VFKGQHEVAGTNSFEDPNSHFNVSNSSNHEEASPKKEVLKSPQFQR 491 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,127,931 Number of Sequences: 5004 Number of extensions: 42522 Number of successful extensions: 148 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 200198394 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -