BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0193 (334 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0032 + 343157-343507 27 4.9 11_06_0557 - 24955837-24956214,24957225-24957395,24957576-249576... 26 8.5 >06_01_0032 + 343157-343507 Length = 116 Score = 26.6 bits (56), Expect = 4.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 22 SVVCVCVYSIAFNINLMTLKYRYKIELIMRLNY 120 + VCVC +A N NL+ L ++L + LNY Sbjct: 75 AAVCVC---LAINANLLGLNLDVPVDLSLLLNY 104 >11_06_0557 - 24955837-24956214,24957225-24957395,24957576-24957635, 24958419-24958623,24958710-24958953,24959103-24959394, 24959734-24960828,24960915-24961409,24961665-24961823, 24961893-24962387 Length = 1197 Score = 25.8 bits (54), Expect = 8.5 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -1 Query: 211 KILNTVVSLQLCSAQLLVRTSETHLMFMRLYNLISLLI 98 K NT V L+ CS L+ S T L + + N+ +LLI Sbjct: 568 KFGNTAVELRKCSTCLIKSLSATSLSDLDVTNVNNLLI 605 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,825,996 Number of Sequences: 37544 Number of extensions: 74717 Number of successful extensions: 130 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 459426840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -