BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0187 (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 24 1.6 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 23 3.6 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 23 3.6 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 6.3 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -2 Query: 306 QIYVHNCAAFLFLLQSIYLPAANLPWDE 223 ++ + NC + L+ + +P NL W E Sbjct: 162 EVCLENCTGYQQYLRLLEVPQINLEWGE 189 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 623 NFKQISIQRLTSIY 582 NFK+ +Q LTSIY Sbjct: 78 NFKENIVQELTSIY 91 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 623 NFKQISIQRLTSIY 582 NFK+ +Q LTSIY Sbjct: 78 NFKENIVQELTSIY 91 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.8 bits (44), Expect = 6.3 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +3 Query: 105 IKHFFAINYQKMNNSAAKVGEIFREAGTAFNKLSEMTMLLHPMG 236 I F A + N+ + ++ T NKL E T L P G Sbjct: 324 IVDFIAAGIHTLGNTLVFLFDLIGRNPTVQNKLYEETYALAPAG 367 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,693 Number of Sequences: 438 Number of extensions: 3422 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -