BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0183 (428 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 32 0.23 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.23 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.54 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.54 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.54 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.54 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.71 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.94 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.94 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.94 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 29 1.2 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 29 1.6 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 28 2.9 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 2.9 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 28 2.9 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 3.8 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_29518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 28 3.8 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 28 3.8 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 28 3.8 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 28 3.8 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 28 3.8 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 28 3.8 SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_4088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 5.0 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 5.0 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 5.0 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_31194| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 27 5.0 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) 27 5.0 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_6786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 27 6.6 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 27 6.6 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 27 6.6 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 27 6.6 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 27 6.6 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_24004| Best HMM Match : EGF (HMM E-Value=5.7e-14) 27 6.6 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 27 6.6 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 27 8.7 SB_51461| Best HMM Match : DRMBL (HMM E-Value=2.6) 27 8.7 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_37086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_25369| Best HMM Match : HEAT (HMM E-Value=3.9e-05) 27 8.7 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 27 8.7 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 27 8.7 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 27 8.7 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 27 8.7 SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_7895| Best HMM Match : uDENN (HMM E-Value=5.7e-25) 27 8.7 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 32.7 bits (71), Expect = 0.13 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -3 Query: 90 DCLHVCGLRLSNPRADSCSPGDPLV 16 D + V GL+ + R++SCSPGDPLV Sbjct: 97 DEIPVVGLKHRDQRSNSCSPGDPLV 121 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 31.9 bits (69), Expect = 0.23 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -3 Query: 111 GDSKQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 G + N L +C L+ +N ++SCSPGDPLV Sbjct: 23 GPHQDCNKMLGLC-LKQANVPSNSCSPGDPLV 53 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.23 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 S PR++SCSPGDPLV Sbjct: 19 SRPRSNSCSPGDPLV 33 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.1 bits (67), Expect = 0.41 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 RL + R++SCSPGDPLV Sbjct: 58 RLGHARSNSCSPGDPLV 74 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 0.54 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -3 Query: 57 NPRADSCSPGDPLV 16 +PR++SCSPGDPLV Sbjct: 67 HPRSNSCSPGDPLV 80 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 30.7 bits (66), Expect = 0.54 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 15 KLVDPPGCRNRHEDSRDA 68 +LVDPPGCRN E RDA Sbjct: 14 ELVDPPGCRNSIEVIRDA 31 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 0.54 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 + PR++SCSPGDPLV Sbjct: 14 ARPRSNSCSPGDPLV 28 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.7 bits (66), Expect = 0.54 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 87 CLHVCGLRLSNP--RADSCSPGDPLV 16 CLH+ GL+ + ++SCSPGDPLV Sbjct: 24 CLHIHGLQGEHRVLTSNSCSPGDPLV 49 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 0.71 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 PR++SCSPGDPLV Sbjct: 2 PRSNSCSPGDPLV 14 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.9 bits (64), Expect = 0.94 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 Query: 15 KLVDPPGCRNRHEDSR 62 +LVDPPGCRN E++R Sbjct: 14 ELVDPPGCRNSMENAR 29 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 29.9 bits (64), Expect = 0.94 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = +3 Query: 15 KLVDPPGCRNR---HEDSRDAGHKHED 86 +LVDPPGCRN ++ D G + ED Sbjct: 14 ELVDPPGCRNSMDPNDQDEDTGDQDED 40 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 0.94 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 Query: 102 KQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 K D L + LS ++SCSPGDPLV Sbjct: 2 KHFTDTLISANIVLSRVSSNSCSPGDPLV 30 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 R+ R++SCSPGDPLV Sbjct: 5 RVKRTRSNSCSPGDPLV 21 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 84 LHVCGLRLSNPRADSCSPGDPLV 16 LH L P ++SCSPGDPLV Sbjct: 128 LHKYRLMFHLPGSNSCSPGDPLV 150 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 57 NPRADSCSPGDPLV 16 N R++SCSPGDPLV Sbjct: 5 NERSNSCSPGDPLV 18 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 R+ R++SCSPGDPLV Sbjct: 26 RICRERSNSCSPGDPLV 42 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 4/20 (20%) Frame = -3 Query: 63 LSNP----RADSCSPGDPLV 16 LSNP R++SCSPGDPLV Sbjct: 13 LSNPPKNLRSNSCSPGDPLV 32 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.1 bits (62), Expect = 1.6 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +3 Query: 15 KLVDPPGCRN-RHEDSRDAG 71 +LVDPPGCRN + RDAG Sbjct: 14 ELVDPPGCRNSMSQGFRDAG 33 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.1 bits (62), Expect = 1.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 15 KLVDPPGCRNRHEDSRDA 68 +LVDPPGCRN ++ R A Sbjct: 14 ELVDPPGCRNSIDNRRSA 31 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 94 K*LSSCLWPASLESSCRFLQPGGSTS 17 K + L A++ SS FLQPGGSTS Sbjct: 2 KHFTDTLISANIRSSIEFLQPGGSTS 27 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 29.1 bits (62), Expect = 1.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 15 KLVDPPGCRNRHED 56 +LVDPPGCRN ED Sbjct: 14 ELVDPPGCRNSIED 27 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 4/30 (13%) Frame = +3 Query: 15 KLVDPPGCRNRHE----DSRDAGHKHEDNH 92 +LVDPPGCRN + D G DNH Sbjct: 31 ELVDPPGCRNSIDGNGVSDGDGGSGDNDNH 60 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 1.6 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 78 VCGLRLSNPRADSCSPGDPLV 16 +C R+SN SCSPGDPLV Sbjct: 27 ICSYRISN----SCSPGDPLV 43 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.1 bits (62), Expect = 1.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 75 CGLRLSNPRADSCSPGDPLV 16 C + R++SCSPGDPLV Sbjct: 37 CSYLVDPARSNSCSPGDPLV 56 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 1.6 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 +N R++SCSPGDPLV Sbjct: 11 ANIRSNSCSPGDPLV 25 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 75 CGLRLSNPRADSCSPGDPLV 16 C + LS ++SCSPGDPLV Sbjct: 2 CHVSLSLRASNSCSPGDPLV 21 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 81 HVCGLRLSNPRADSCSPGDPLV 16 H+ R S ++SCSPGDPLV Sbjct: 19 HIIKSRCSCQSSNSCSPGDPLV 40 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 L+N ++SCSPGDPLV Sbjct: 16 LTNKSSNSCSPGDPLV 31 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 57 NPRADSCSPGDPLV 16 N R++SCSPGDPLV Sbjct: 37 NYRSNSCSPGDPLV 50 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -3 Query: 69 LRLSNPRADSCSPGDPLV 16 LR++ ++SCSPGDPLV Sbjct: 7 LRITKVLSNSCSPGDPLV 24 >SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 640 Score = 28.7 bits (61), Expect = 2.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 126 CHCRDGDSKQTNDCL 82 CHCRDG+S Q N+ + Sbjct: 336 CHCRDGESVQVNNAM 350 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 69 LRLSNPRADSCSPGDPLV 16 LR P ++SCSPGDPLV Sbjct: 53 LRTIPPVSNSCSPGDPLV 70 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 2.2 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P+++SCSPGDPLV Sbjct: 30 PQSNSCSPGDPLV 42 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 2.2 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -3 Query: 99 QTNDCLHVCGLRLSNPRADSCSPGDPLV 16 QT + H +RLSN SCSPGDPLV Sbjct: 2 QTLEFSHARLIRLSN----SCSPGDPLV 25 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 L R++SCSPGDPLV Sbjct: 25 LCRSRSNSCSPGDPLV 40 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 2.9 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 3/20 (15%) Frame = +3 Query: 15 KLVDPPGCRNR---HEDSRD 65 +LVDPPGCRN H+D +D Sbjct: 14 ELVDPPGCRNSIKVHKDVKD 33 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 28.3 bits (60), Expect = 2.9 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 ++ + R++SCSPGDPLV Sbjct: 553 KILSDRSNSCSPGDPLV 569 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 28.3 bits (60), Expect = 2.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 Query: 15 KLVDPPGCRNRHED 56 +LVDPPGCRN +D Sbjct: 14 ELVDPPGCRNSMDD 27 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 2.9 Identities = 13/18 (72%), Positives = 16/18 (88%), Gaps = 1/18 (5%) Frame = -3 Query: 66 RLS-NPRADSCSPGDPLV 16 RLS + R++SCSPGDPLV Sbjct: 20 RLSKSKRSNSCSPGDPLV 37 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 2.9 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 105 SKQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 S++ N + +C + R++SCSPGDPLV Sbjct: 3 SQRINQSI-ICNSLSYSFRSNSCSPGDPLV 31 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 2.9 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 69 LRLSNPRADSCSPGDPLV 16 +RLS R++SCSPGDPLV Sbjct: 60 IRLS--RSNSCSPGDPLV 75 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 2.9 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 3/24 (12%) Frame = -3 Query: 78 VCGLRLS---NPRADSCSPGDPLV 16 +CG R+S ++SCSPGDPLV Sbjct: 1 MCGSRVSIKQQATSNSCSPGDPLV 24 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 2.9 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 + N +++SCSPGDPLV Sbjct: 7 IHNHKSNSCSPGDPLV 22 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -3 Query: 69 LRLSNPRADSCSPGDPLV 16 L ++N ++SCSPGDPLV Sbjct: 39 LLVANKPSNSCSPGDPLV 56 >SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 2.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 79 CLWPASLESSCRFLQPGGSTS 17 C + + SS FLQPGGSTS Sbjct: 2 CRIDSKIRSSIEFLQPGGSTS 22 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 28.3 bits (60), Expect = 2.9 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 + P ++SCSPGDPLV Sbjct: 3 ARPTSNSCSPGDPLV 17 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 81 HVCGLRLSNPRADSCSPGDPLV 16 + G L ++SCSPGDPLV Sbjct: 5 YTAGTNLVTASSNSCSPGDPLV 26 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 R + R++SCSPGDPLV Sbjct: 3 RKGDRRSNSCSPGDPLV 19 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 9 PASNSCSPGDPLV 21 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 15 KLVDPPGCRNRHEDSRDA 68 +LVDPPGCRN + DA Sbjct: 14 ELVDPPGCRNSIHKALDA 31 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 140 PSSNSCSPGDPLV 152 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 15 PTSNSCSPGDPLV 27 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 15 KLVDPPGCRNRHEDSRDAGHKHE 83 +LVDPPGCRN + +G +E Sbjct: 14 ELVDPPGCRNSMHIGQASGRGNE 36 >SB_29518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 27.9 bits (59), Expect = 3.8 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 5/57 (8%) Frame = -3 Query: 183 SGCEVIVSIFEHIREICDGCHCRDGDSKQTNDCL-----HVCGLRLSNPRADSCSPG 28 S CE+ +I E +C C DG + T C +C +++SN DSC PG Sbjct: 16 SRCEI--NIDECQSNLCVNGSCVDGVAGYTCKCDAGFEGRLCDVKISNCSEDSCYPG 70 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 SN ++SCSPGDPLV Sbjct: 19 SNISSNSCSPGDPLV 33 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 20 PTSNSCSPGDPLV 32 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 15 KLVDPPGCRNRHEDS 59 +LVDPPGCRN DS Sbjct: 31 ELVDPPGCRNSIMDS 45 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 R S+ ++SCSPGDPLV Sbjct: 61 RKSSTTSNSCSPGDPLV 77 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 69 LRLSNPRADSCSPGDPLV 16 + L +++SCSPGDPLV Sbjct: 15 ITLQEKKSNSCSPGDPLV 32 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 27.9 bits (59), Expect = 3.8 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -3 Query: 108 DSKQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 D+ + + LH+ L L+ ++SCSPGDPLV Sbjct: 6 DTLISANILHLYDLALTT--SNSCSPGDPLV 34 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 46 PTSNSCSPGDPLV 58 >SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 70 PASLESSCRFLQPGGSTS 17 P LE + FLQPGGSTS Sbjct: 21 PTLLELTIEFLQPGGSTS 38 >SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 3.8 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 79 CLWPASLESSCRFLQPGGSTS 17 CLW S+ FLQPGGSTS Sbjct: 21 CLWVVSI---IEFLQPGGSTS 38 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 +++ R++SCSPGDPLV Sbjct: 56 VTHRRSNSCSPGDPLV 71 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 +S R++SCSPGDPLV Sbjct: 4 VSFARSNSCSPGDPLV 19 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 + P ++SCSPGDPLV Sbjct: 94 AQPPSNSCSPGDPLV 108 >SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 82 SCLWPASLESSCRFLQPGGSTS 17 SC+ + +S FLQPGGSTS Sbjct: 3 SCVTWSIFDSGIEFLQPGGSTS 24 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 57 NPRADSCSPGDPLV 16 +P ++SCSPGDPLV Sbjct: 23 SPGSNSCSPGDPLV 36 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 18 PASNSCSPGDPLV 30 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 3.8 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 15 KLVDPPGCRNRHEDSRDAG 71 +LVDPPGCRN DSR G Sbjct: 77 ELVDPPGCRN-SMDSRVVG 94 >SB_4088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 895 Score = 27.9 bits (59), Expect = 3.8 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Frame = -3 Query: 192 GKHSGCEVIVSIFEHIREICDGCHCRDGDSKQTNDCL-----HVCGLRLSNPRADSCSPG 28 G +G ++I E +C C DG + T C +C +++SN DSC PG Sbjct: 157 GGFNGSRCEMNIDECQSNLCVNGSCVDGVAGYTCKCDAGFKGRLCDVKISNCSEDSCYPG 216 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.5 bits (58), Expect = 5.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 70 PASLESSCRFLQPGGSTS 17 P++L + FLQPGGSTS Sbjct: 31 PSTLGQNIEFLQPGGSTS 48 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 182 PPSNSCSPGDPLV 194 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 16 PPSNSCSPGDPLV 28 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 381 RSNSCSPGDPLV 392 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/16 (75%), Positives = 14/16 (87%), Gaps = 2/16 (12%) Frame = -3 Query: 57 NPR--ADSCSPGDPLV 16 NPR ++SCSPGDPLV Sbjct: 13 NPRTTSNSCSPGDPLV 28 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 13 RSNSCSPGDPLV 24 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 63 PLSNSCSPGDPLV 75 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 875 RSNSCSPGDPLV 886 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 24 PGSNSCSPGDPLV 36 >SB_31194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 73 WPASLESSCRFLQPGGSTS 17 +PAS+ FLQPGGSTS Sbjct: 75 FPASVCDCIEFLQPGGSTS 93 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 66 RSNSCSPGDPLV 77 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 16 PLSNSCSPGDPLV 28 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 19 PPSNSCSPGDPLV 31 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 57 NPRADSCSPGDPLV 16 +P ++SCSPGDPLV Sbjct: 1 DPVSNSCSPGDPLV 14 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 6 RSNSCSPGDPLV 17 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 5.0 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 +LS ++SCSPGDPLV Sbjct: 2 KLSYRTSNSCSPGDPLV 18 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 39 PPSNSCSPGDPLV 51 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 92 RSNSCSPGDPLV 103 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 Query: 15 KLVDPPGCRNRHED 56 +LVDPPGCRN +D Sbjct: 14 ELVDPPGCRNSIKD 27 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 44 RSNSCSPGDPLV 55 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 11 RSNSCSPGDPLV 22 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 +N +++SCSPGDPLV Sbjct: 11 ANIQSNSCSPGDPLV 25 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 17 RSNSCSPGDPLV 28 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 59 RSNSCSPGDPLV 70 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 322 RSNSCSPGDPLV 333 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 126 CHCRDGDSKQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 C ++ + ++ +CL + +SN SCSPGDPLV Sbjct: 65 CGEQNSNDRRGEECLTLTQRIVSN----SCSPGDPLV 97 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) Length = 942 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 Query: 6 GRSKLVDPPGCRNRHEDSRDAGHKHEDNHLFVYYRHRGNGS 128 G + D P + + +AG+KH+D Y+H GS Sbjct: 767 GTGSIRDIPAISDIRYGASEAGYKHDDTASEAGYKHNDTGS 807 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.5 bits (58), Expect = 5.0 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 64 SLESSCRFLQPGGSTS 17 SL+++ FLQPGGSTS Sbjct: 34 SLDTAIEFLQPGGSTS 49 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 71 PPSNSCSPGDPLV 83 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 55 RSNSCSPGDPLV 66 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 ++N ++SCSPGDPLV Sbjct: 13 ITNISSNSCSPGDPLV 28 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 214 RSNSCSPGDPLV 225 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 11 PGSNSCSPGDPLV 23 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 19 RSNSCSPGDPLV 30 >SB_6786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.5 bits (58), Expect = 5.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 70 PASLESSCRFLQPGGSTS 17 P +E + FLQPGGSTS Sbjct: 36 PGIIECNIEFLQPGGSTS 53 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 1 RSNSCSPGDPLV 12 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 35 RSNSCSPGDPLV 46 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 51 RADSCSPGDPLV 16 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 75 CGLRLSNPRADSCSPGDPLV 16 CG + SN SCSPGDPLV Sbjct: 2 CGKKASN----SCSPGDPLV 17 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 29 PVSNSCSPGDPLV 41 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 R S ++SCSPGDPLV Sbjct: 18 RRSKRASNSCSPGDPLV 34 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 78 VCGLRLSNPRADSCSPGDPLV 16 V G + ++SCSPGDPLV Sbjct: 7 VAGASIVQQISNSCSPGDPLV 27 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 15 KLVDPPGCRNRHEDSRDAG 71 +LVDPPGCRN R G Sbjct: 14 ELVDPPGCRNSMLPKRTEG 32 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 15 KLVDPPGCRNRHED 56 +LVDPPGCRN D Sbjct: 34 ELVDPPGCRNSMPD 47 >SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.1 bits (57), Expect = 6.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 61 LESSCRFLQPGGSTS 17 LE S FLQPGGSTS Sbjct: 17 LEFSIEFLQPGGSTS 31 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.1 bits (57), Expect = 6.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 64 SLESSCRFLQPGGSTS 17 S +SS FLQPGGSTS Sbjct: 9 SHQSSIEFLQPGGSTS 24 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 +L ++SCSPGDPLV Sbjct: 236 KLKKKTSNSCSPGDPLV 252 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 117 RDGDSKQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 R+ + N +C ++ P ++SCSPGDPLV Sbjct: 135 RESPQSKANGDSFLCEDAVAFP-SNSCSPGDPLV 167 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 102 KQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 K D L + L ++SCSPGDPLV Sbjct: 2 KHFTDTLISANIILIKITSNSCSPGDPLV 30 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 6.6 Identities = 12/14 (85%), Positives = 13/14 (92%), Gaps = 1/14 (7%) Frame = -3 Query: 54 PRA-DSCSPGDPLV 16 PRA +SCSPGDPLV Sbjct: 8 PRASNSCSPGDPLV 21 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.1 bits (57), Expect = 6.6 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -3 Query: 111 GDSKQTNDCLHV-CGLRLSNPRA--DSCSPGDPLV 16 GD K +++ V C + S A +SCSPGDPLV Sbjct: 57 GDQKHSSNVAKVHCRKQRSREVATSNSCSPGDPLV 91 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 70 PASLESSCRFLQPGGSTS 17 P +L + FLQPGGSTS Sbjct: 3 PFALSTKIEFLQPGGSTS 20 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 54 PRADSCSPGDPLV 16 P ++SCSPGDPLV Sbjct: 63 PVSNSCSPGDPLV 75 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 114 DGDSKQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 D + D +H ++ S+ ++SCSPGDPLV Sbjct: 32 DNFKPRPEDKIHKI-VKSSSRASNSCSPGDPLV 63 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/29 (44%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 99 QTN-DCLHVCGLRLSNPRADSCSPGDPLV 16 +TN DC + ++ + +++SCSPGDPLV Sbjct: 3 RTNFDCENQLFVQGNCMKSNSCSPGDPLV 31 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 +S ++SCSPGDPLV Sbjct: 113 VSKAESNSCSPGDPLV 128 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 69 LRLSNPRADSCSPGDPLV 16 + L+ ++SCSPGDPLV Sbjct: 29 ISLATKTSNSCSPGDPLV 46 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 L N ++SCSPGDPLV Sbjct: 2 LHNVISNSCSPGDPLV 17 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 27.1 bits (57), Expect = 6.6 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -3 Query: 72 GLRLSNPRA--DSCSPGDPLV 16 G +PR+ +SCSPGDPLV Sbjct: 23 GFSTESPRSISNSCSPGDPLV 43 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 ++N ++SCSPGDPLV Sbjct: 4 ITNGISNSCSPGDPLV 19 >SB_24004| Best HMM Match : EGF (HMM E-Value=5.7e-14) Length = 808 Score = 27.1 bits (57), Expect = 6.6 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 5/57 (8%) Frame = -3 Query: 183 SGCEVIVSIFEHIREICDGCHCRDGDSKQTNDCL-----HVCGLRLSNPRADSCSPG 28 S CE+ +I E +C C DG + T C +C +++SN DSC PG Sbjct: 664 SRCEM--NIDECQSNLCVNGSCVDGVAGYTCKCDAGFKGRLCDVKISNCSEDSCYPG 718 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 27.1 bits (57), Expect = 6.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -3 Query: 174 EVIVSIFEHIREICDGCH 121 +VI++ +EH + CDGCH Sbjct: 356 DVIIARYEHNKCRCDGCH 373 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 15 KLVDPPGCRNRHE 53 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSME 26 >SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 +N ++SCSPGDPLV Sbjct: 40 ANKGSNSCSPGDPLV 54 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 SN ++SCSPGDPLV Sbjct: 60 SNFLSNSCSPGDPLV 74 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 R++ ++SCSPGDPLV Sbjct: 59 RITRGGSNSCSPGDPLV 75 >SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 70 PASLESSCRFLQPGGSTS 17 P + +S FLQPGGSTS Sbjct: 28 PFRIHASIEFLQPGGSTS 45 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -3 Query: 93 NDCLHVC-GLRLSNPRADSCSPGDPLV 16 ++CL+ C + +SN SCSPGDPLV Sbjct: 15 SNCLNKCHNIVISN----SCSPGDPLV 37 >SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 RL ++SCSPGDPLV Sbjct: 37 RLQISTSNSCSPGDPLV 53 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = -3 Query: 78 VCGLRLSNPRADSCSPGDPLV 16 +C ++ + +++SCSPGDPLV Sbjct: 3 LCRMK-TREKSNSCSPGDPLV 22 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 +N ++SCSPGDPLV Sbjct: 11 ANIASNSCSPGDPLV 25 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 LS ++SCSPGDPLV Sbjct: 77 LSRFTSNSCSPGDPLV 92 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 58 ESSCRFLQPGGSTS 17 +SS FLQPGGSTS Sbjct: 23 DSSIEFLQPGGSTS 36 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 +S+ ++SCSPGDPLV Sbjct: 14 VSHNTSNSCSPGDPLV 29 >SB_51461| Best HMM Match : DRMBL (HMM E-Value=2.6) Length = 455 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -3 Query: 204 FHYFGKHSGCEVIVSIFEHIREICDGCHCRDGDSKQTNDCLHVCG 70 FH G + E+ S F + E+ D C GD + + C H G Sbjct: 294 FHAIGDY---EMFDSCFHMLYEMFDSCFHTIGDYVRIDSCFHTIG 335 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 +NP ++SCSPGDPLV Sbjct: 61 TNP-SNSCSPGDPLV 74 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 102 KQTNDCLHVCGLRLSNPRADSCSPGDPLV 16 K D L ++ + ++SCSPGDPLV Sbjct: 2 KHFTDTLISANIKGRHCASNSCSPGDPLV 30 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 66 RLSNPRADSCSPGDPLV 16 R S ++SCSPGDPLV Sbjct: 15 RGSQTASNSCSPGDPLV 31 >SB_37086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 26.6 bits (56), Expect = 8.7 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 391 TPLIDRRSR-LLLANSVRIASSSGKPIAFKSSSWVSPSEAK 272 TP++ + + L A + +A +S A SSS VSP EA+ Sbjct: 433 TPMLSQNTASLTTATTKSLAQTSASETASSSSSGVSPHEAR 473 >SB_25369| Best HMM Match : HEAT (HMM E-Value=3.9e-05) Length = 415 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 50 RGFERRRPQT*RQSFVCLLSPSRQWQPSQISL 145 +GF RP+ + ++C LS QW P Q+ L Sbjct: 270 KGFHDTRPEC-KYLYLCALSHLLQWIPKQVLL 300 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 +N ++SCSPGDPLV Sbjct: 114 TNEVSNSCSPGDPLV 128 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 15 KLVDPPGCRNRHEDS 59 +LVDPPGCRN D+ Sbjct: 14 ELVDPPGCRNSMFDT 28 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 15 KLVDPPGCRNRHEDSRDAGHKHEDNHLFV 101 +LVDPPGCRN + A ++ E ++ Sbjct: 14 ELVDPPGCRNSMSNPFAAFNQREKQQRYM 42 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 26.6 bits (56), Expect = 8.7 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -3 Query: 138 ICDGCHCRD-GDSKQT-NDCLHVCGLRLSNPRADSCSPGDPLV 16 IC+ C GD T +C +V N ++SCSPGDPLV Sbjct: 27 ICEKCEKNKVGDEYHTLMECDYV------NDISNSCSPGDPLV 63 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/14 (78%), Positives = 12/14 (85%), Gaps = 1/14 (7%) Frame = +3 Query: 15 KLVDPPGCRNR-HE 53 +LVDPPGCRN HE Sbjct: 14 ELVDPPGCRNSIHE 27 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 S+ ++SCSPGDPLV Sbjct: 22 SHTASNSCSPGDPLV 36 >SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -2 Query: 88 LSSCLWPA--SLESSCRFLQPGGSTS 17 L+S L P +L ++ FLQPGGSTS Sbjct: 28 LASSLSPTDPTLRANIEFLQPGGSTS 53 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 60 SNPRADSCSPGDPLV 16 +N ++SCSPGDPLV Sbjct: 11 ANITSNSCSPGDPLV 25 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 15 KLVDPPGCRNRHE 53 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSIE 26 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = +3 Query: 15 KLVDPPGCRNR--HEDSRDAG 71 +LVDPPGCRN + S+D G Sbjct: 14 ELVDPPGCRNSIINRFSKDIG 34 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 72 GLRLSNPRADSCSPGDPLV 16 G+R SN SCSPGDPLV Sbjct: 8 GIRTSN----SCSPGDPLV 22 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 69 LRLSNPRADSCSPGDPLV 16 LR ++SCSPGDPLV Sbjct: 7 LRQLKKASNSCSPGDPLV 24 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 63 LSNPRADSCSPGDPLV 16 + NP ++SCSPGDPLV Sbjct: 72 VDNP-SNSCSPGDPLV 86 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 26.6 bits (56), Expect = 8.7 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +3 Query: 12 SKLVDPPGCRN 44 ++LVDPPGCRN Sbjct: 318 TELVDPPGCRN 328 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 57 NPRADSCSPGDPLV 16 N ++SCSPGDPLV Sbjct: 6 NVTSNSCSPGDPLV 19 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 87 CLHVCGLRLSNPRADSCSPGDPLV 16 C C + +SN SCSPGDPLV Sbjct: 82 CSAECVMTISN----SCSPGDPLV 101 >SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 76 LWPASLESSCRFLQPGGSTS 17 L P ++ S FLQPGGSTS Sbjct: 49 LSPVAILISIEFLQPGGSTS 68 >SB_7895| Best HMM Match : uDENN (HMM E-Value=5.7e-25) Length = 945 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = -1 Query: 137 FVTAAIAAMAIVNKQMIVFMFVACVSRILVPIPAARGIH*FRAPT 3 F++++ + V + M+ M+ S + +PI A + RAPT Sbjct: 254 FISSSFVQLTTVTRAMLALMYPLKFSYVYIPILPAALLDFLRAPT 298 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,881,296 Number of Sequences: 59808 Number of extensions: 253680 Number of successful extensions: 2446 Number of sequences better than 10.0: 206 Number of HSP's better than 10.0 without gapping: 2351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2441 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -