BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0180 (551 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68003-1|CAA91975.1| 664|Caenorhabditis elegans Hypothetical pr... 28 3.9 U76403-1|AAB39735.1| 664|Caenorhabditis elegans degenerin protein. 28 3.9 AL032675-1|CAA21779.1| 963|Caenorhabditis elegans Hypothetical ... 28 5.1 AY303575-1|AAP57297.1| 382|Caenorhabditis elegans cell death-re... 27 6.8 AC024791-9|AAF60653.1| 382|Caenorhabditis elegans Cell-death-re... 27 6.8 Z81147-6|CAB03535.1| 506|Caenorhabditis elegans Hypothetical pr... 27 9.0 M80650-1|AAA27985.1| 298|Caenorhabditis elegans alpha-collagen ... 27 9.0 >Z68003-1|CAA91975.1| 664|Caenorhabditis elegans Hypothetical protein E02H4.1 protein. Length = 664 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -3 Query: 384 RFSNAYDRASSFGNTNSSSAHCLTTRRLFFAPRPGQQHAK 265 R+ + R++ +TN+++ +CLTT + + Q+H K Sbjct: 493 RYPKPWKRSAWCDSTNTTTLNCLTTEGAKLSTKENQKHCK 532 >U76403-1|AAB39735.1| 664|Caenorhabditis elegans degenerin protein. Length = 664 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -3 Query: 384 RFSNAYDRASSFGNTNSSSAHCLTTRRLFFAPRPGQQHAK 265 R+ + R++ +TN+++ +CLTT + + Q+H K Sbjct: 493 RYPKPWKRSAWCDSTNTTTLNCLTTEGAKLSTKENQKHCK 532 >AL032675-1|CAA21779.1| 963|Caenorhabditis elegans Hypothetical protein VT23B5.1 protein. Length = 963 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = -3 Query: 456 IRDFLPDLCCTSTSIGTEDPGT*NRFSNAYDRASSFGNTNSSSAHCLTT 310 + D L +CC + + T T D S GNT + CLT+ Sbjct: 455 VMDLLKKICCDNLQVNTSKNDT--IIDAILDNISESGNTRKTQIACLTS 501 >AY303575-1|AAP57297.1| 382|Caenorhabditis elegans cell death-related nuclease 1 protein. Length = 382 Score = 27.5 bits (58), Expect = 6.8 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +2 Query: 221 EMSYGIERFFLLSYCLACCW----PGLGAKNNLRVVRQWAELEFVFPNEEARSY 370 EM +E F L L C + G+G K + ++RQ +E + N + Y Sbjct: 215 EMKLSVEEFIDLCILLGCDYCGTIRGVGPKKAVELIRQHKNIETILENIDQNKY 268 >AC024791-9|AAF60653.1| 382|Caenorhabditis elegans Cell-death-related nuclease protein1 protein. Length = 382 Score = 27.5 bits (58), Expect = 6.8 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +2 Query: 221 EMSYGIERFFLLSYCLACCW----PGLGAKNNLRVVRQWAELEFVFPNEEARSY 370 EM +E F L L C + G+G K + ++RQ +E + N + Y Sbjct: 215 EMKLSVEEFIDLCILLGCDYCGTIRGVGPKKAVELIRQHKNIETILENIDQNKY 268 >Z81147-6|CAB03535.1| 506|Caenorhabditis elegans Hypothetical protein T09E11.8 protein. Length = 506 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 204 WMLLNWKC-RTESSDFFYCHIVWRAVGPVS 290 W + W C T SD+FYC + R G VS Sbjct: 74 WKPIRWFCLNTTCSDYFYCSMATR-FGSVS 102 >M80650-1|AAA27985.1| 298|Caenorhabditis elegans alpha-collagen protein. Length = 298 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 86 GCPNRETSQHCCPRAEFLQPGDP 18 G P + SQ C PR E L PG+P Sbjct: 196 GAPEHQESQEC-PRGEPLIPGEP 217 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,843,422 Number of Sequences: 27780 Number of extensions: 275242 Number of successful extensions: 759 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -