BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0177 (628 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0237 - 1972699-1972796,1973618-1974334,1975387-1976191 28 7.0 02_05_0967 - 33148283-33148524,33148602-33148881,33148959-331491... 27 9.2 >01_01_0237 - 1972699-1972796,1973618-1974334,1975387-1976191 Length = 539 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -1 Query: 211 LTLGQCHIQSFTNASQHVTTLMQFQIELKSHSIV 110 LT GQC I+SF NAS + L QF+I + +V Sbjct: 352 LTDGQCVIESFVNASSDL-GLTQFKISPINRELV 384 >02_05_0967 - 33148283-33148524,33148602-33148881,33148959-33149151, 33149244-33149324,33149395-33149520,33149758-33150137, 33150367-33150394,33150816-33150979,33151920-33152039, 33152168-33152416 Length = 620 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 218 SMRTGTYRFFDIDKYNIDFSIC 283 S + TY+ FD+ YN +SIC Sbjct: 352 SAQDSTYKVFDLKNYNFLYSIC 373 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,410,990 Number of Sequences: 37544 Number of extensions: 245513 Number of successful extensions: 541 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -