BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0177 (628 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48009-10|CAA88082.1| 331|Caenorhabditis elegans Hypothetical p... 29 2.7 Z77665-3|CAB01218.1| 103|Caenorhabditis elegans Hypothetical pr... 28 6.3 >Z48009-10|CAA88082.1| 331|Caenorhabditis elegans Hypothetical protein AH6.14 protein. Length = 331 Score = 29.1 bits (62), Expect = 2.7 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 511 NKALFES*KPQILLENIFSKNLIQ-FYIDDSITSLFSRRGRLRFVSHIVITYTN 353 NK+LF+ ++LE++F NL Q FY ++IT L+ +I+ T +N Sbjct: 47 NKSLFQWSTKMLILESLFFANLYQIFYGIEAITILYKHHFMTSDFCNIMQTESN 100 >Z77665-3|CAB01218.1| 103|Caenorhabditis elegans Hypothetical protein K02E11.4 protein. Length = 103 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 589 LPLSLLLTATMHRQRSPSAVTSRNRNNKAL 500 LP+S +++++ PS VT+ N+N KAL Sbjct: 45 LPVSANYRRLVNKKKVPSGVTTYNKNKKAL 74 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,087,869 Number of Sequences: 27780 Number of extensions: 246834 Number of successful extensions: 553 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -