Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0176
         (599 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ989013-1|ABK97614.1|  378|Anopheles gambiae gustatory receptor...    23   7.5  
AY341224-1|AAR13788.1|  287|Anopheles gambiae TOLL9 protein.           23   7.5  
AY341223-1|AAR13787.1|  287|Anopheles gambiae TOLL9 protein.           23   7.5  
AY341222-1|AAR13786.1|  287|Anopheles gambiae TOLL9 protein.           23   7.5  
AY341221-1|AAR13785.1|  287|Anopheles gambiae TOLL9 protein.           23   7.5  
AY341220-1|AAR13784.1|  287|Anopheles gambiae TOLL9 protein.           23   7.5  
AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.           23   7.5  

>DQ989013-1|ABK97614.1|  378|Anopheles gambiae gustatory receptor 24
           protein.
          Length = 378

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = -2

Query: 235 VILLYLSLFAELSVSCTNLNIIYVSFYLFIS*CVIST 125
           VI + L +   LSV+ T++ ++       I  CV+ T
Sbjct: 131 VIAILLPILCSLSVAITHVTMVDFKLLQVIPYCVLDT 167


>AY341224-1|AAR13788.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 86  YWFRFNYFFNI 54
           YWF   YFF I
Sbjct: 166 YWFHIKYFFKI 176


>AY341223-1|AAR13787.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 86  YWFRFNYFFNI 54
           YWF   YFF I
Sbjct: 166 YWFHIKYFFKI 176


>AY341222-1|AAR13786.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 86  YWFRFNYFFNI 54
           YWF   YFF I
Sbjct: 166 YWFHIKYFFKI 176


>AY341221-1|AAR13785.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 86  YWFRFNYFFNI 54
           YWF   YFF I
Sbjct: 166 YWFHIKYFFKI 176


>AY341220-1|AAR13784.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 86  YWFRFNYFFNI 54
           YWF   YFF I
Sbjct: 166 YWFHIKYFFKI 176


>AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.
          Length = 576

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 86  YWFRFNYFFNI 54
           YWF   YFF I
Sbjct: 393 YWFHIKYFFKI 403


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 630,522
Number of Sequences: 2352
Number of extensions: 13002
Number of successful extensions: 14
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58029966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)