BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0173 (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08960.1 68414.m00996 cation exchanger, putative (CAX11) simi... 33 0.15 At3g17780.1 68416.m02268 expressed protein 31 0.81 At1g48440.1 68414.m05415 expressed protein 30 1.4 At3g11370.1 68416.m01382 DC1 domain-containing protein contains ... 27 7.6 >At1g08960.1 68414.m00996 cation exchanger, putative (CAX11) similar to sodium/calcium exchanger protein [Mus musculus] gi|13925661|gb|AAK49407; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 415 Score = 33.1 bits (72), Expect = 0.15 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 227 TEIAVVLLLTLPIASPSRWQKFFKSKFLAY 316 T ++V+L LT+P SPS W +F++S + + Sbjct: 168 TPVSVLLNLTIPKPSPSEWSRFYRSANIVF 197 >At3g17780.1 68416.m02268 expressed protein Length = 129 Score = 30.7 bits (66), Expect = 0.81 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +2 Query: 188 MSLQWTIIATFLYTEIAVVLLLTLP 262 M+LQW I++ + E+A+ ++LTLP Sbjct: 1 MALQWLILSYVVAAEVAIAVILTLP 25 >At1g48440.1 68414.m05415 expressed protein Length = 129 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 188 MSLQWTIIATFLYTEIAVVLLLTLP 262 M+LQW I++ + E+ + L+LTLP Sbjct: 1 MALQWLILSYVVAVEVVITLVLTLP 25 >At3g11370.1 68416.m01382 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 589 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -1 Query: 459 LPCISASRCWWSDGSIFEYFCISRIASSRHNTSTPMRIRK*IDACP 322 L CI S + GSIF+Y S++ R++ ST + + D CP Sbjct: 519 LHCIFGSSSYMKPGSIFDY-NYSKLEVLRNSNSTRPQCTRCGDRCP 563 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,635,586 Number of Sequences: 28952 Number of extensions: 238331 Number of successful extensions: 534 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -