BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0165 (645 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 128 3e-30 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 77 1e-14 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 76 2e-14 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 70 2e-12 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 59 3e-09 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 54 8e-08 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 54 1e-07 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 50 1e-06 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 50 2e-06 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 49 4e-06 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 48 5e-06 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 48 5e-06 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 48 7e-06 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 48 9e-06 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 47 1e-05 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 45 5e-05 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 45 6e-05 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 44 1e-04 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 43 2e-04 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 42 4e-04 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 41 7e-04 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 41 0.001 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 40 0.002 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 39 0.003 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 39 0.004 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 38 0.009 SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) 37 0.012 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 37 0.016 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.021 SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 36 0.037 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.065 SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.086 SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) 34 0.11 SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 33 0.15 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 33 0.20 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 33 0.26 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 32 0.35 SB_44858| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 31 1.1 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 1.1 SB_19477| Best HMM Match : GST_C (HMM E-Value=0.64) 31 1.1 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 30 1.4 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 30 1.9 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 30 1.9 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 29 2.4 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 29 2.4 SB_35731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 29 3.2 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_23411| Best HMM Match : Glyco_transf_8 (HMM E-Value=8.4e-15) 29 3.2 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 29 4.3 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 28 5.7 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_7229| Best HMM Match : Neurokinin_B (HMM E-Value=7.9) 28 5.7 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_44083| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 7.5 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 9.9 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 9.9 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_8443| Best HMM Match : Calx-beta (HMM E-Value=0) 27 9.9 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 27 9.9 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 27 9.9 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 27 9.9 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 27 9.9 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 128 bits (310), Expect = 3e-30 Identities = 57/119 (47%), Positives = 82/119 (68%) Frame = +1 Query: 256 EPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMV 435 E E RK+FIGGL++ TT+ LK+++ QWG IVD V+MK + RS+GFGF+TY + V Sbjct: 45 ESEKLRKIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMK--RDGRSRGFGFVTYESSDSV 102 Query: 436 DEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFST 612 +E + H +D R +EPKR+VPR+E PEA + +K+FV GL EED++EYF++ Sbjct: 103 NEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNS 161 Score = 56.4 bits (130), Expect = 2e-08 Identities = 30/107 (28%), Positives = 56/107 (52%), Gaps = 7/107 (6%) Frame = +1 Query: 229 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQ------WGEIVDVVVMKD-PKTK 387 P + E TRK+F+GGL T + +KE++ GE++DV + +D K Sbjct: 125 PRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPK 184 Query: 388 RSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE 528 R +GF F+T+ +V++ + H+I + E K+A P+ +++ + Sbjct: 185 RIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQSAMRKKD 231 Score = 35.1 bits (77), Expect = 0.049 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 532 SATVKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 S ++K+F+ GL + EE L++YFS +G IV ++ Sbjct: 46 SEKLRKIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIM 82 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 103 bits (246), Expect = 2e-22 Identities = 48/113 (42%), Positives = 78/113 (69%), Gaps = 4/113 (3%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQ----AHMVDE 441 KLF+GGL+ TT+ +L+E++E +GE+ DVVV+ D TK+S+GFG++T++ +++ + Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKD 74 Query: 442 AQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLRE 600 N H+IDG+ VE KRA+PR++ T KK+FV GL +D +ED++E Sbjct: 75 KVENGAHRIDGKEVEVKRAIPRDDNSATSHEKT-KKIFVGGLPEDATKEDIQE 126 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 4/87 (4%) Frame = +1 Query: 262 EHTRKLFIGGLDYRTTDSSLKE----FYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAH 429 E T+K+F+GGL T ++E E+ + VD+++ K+ +TK +GF F+ + Sbjct: 105 EKTKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKH-RGFAFVELNNED 163 Query: 430 MVDEAQNNRPHKIDGRIVEPKRAVPRE 510 DE + + G++VE K+A PR+ Sbjct: 164 QADELCCVKKIHVKGKMVEAKKATPRD 190 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 547 KLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 KLFV GL ++ E LREYF +G + V V+ Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGELTDVVVI 46 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 86.6 bits (205), Expect = 2e-17 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 2/123 (1%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-- 450 L + GL Y TT+S +KE++ ++GEI V DP T+RS+GFGF+ + + ++A+N Sbjct: 117 LIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKD---EDAKNVL 173 Query: 451 NRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGNIVS 630 + H+I GR+ E + P+EE+ P KKLFV L + E+ L EYF+ FG + Sbjct: 174 STSHRIQGRLCEVRLPRPKEELNVP------KKLFVGRLPESTTEKTLMEYFAQFGEVTD 227 Query: 631 VSV 639 V + Sbjct: 228 VYI 230 Score = 44.8 bits (101), Expect = 6e-05 Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +1 Query: 253 EEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITY-SQAH 429 EE +KLF+G L TT+ +L E++ Q+GE+ DV + PK R FGF+T+ S A+ Sbjct: 193 EELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYI---PKPFRH--FGFVTFASVAN 247 Query: 430 MVDEAQNN 453 V A N Sbjct: 248 CVSIAFEN 255 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 502 PREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGNI 624 P +I + E V L V GL E +++EYF+ FG I Sbjct: 102 PETKITKVEG-VDVGDLIVLGLPYATTESEMKEYFTRFGEI 141 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 77.0 bits (181), Expect = 1e-14 Identities = 44/125 (35%), Positives = 67/125 (53%), Gaps = 1/125 (0%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 453 KLF+GGL Y TT SLKE++ ++GE+V V + D T R +GF F+ + Sbjct: 30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFK----------- 78 Query: 454 RPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYF-STFGNIVS 630 H+ + ++PK A P I +P VKK+FV GLK + +E +REYF + + Sbjct: 79 --HQSEADAIDPKPAAP---IGKP-PHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKE 132 Query: 631 VSVVT 645 + +T Sbjct: 133 IEYIT 137 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/88 (30%), Positives = 52/88 (59%), Gaps = 3/88 (3%) Frame = +1 Query: 256 EPEHTR--KLFIGGLDYRTTDSSLKEFY-EQWGEIVDVVVMKDPKTKRSKGFGFITYSQA 426 +P H R K+F+GGL T+D ++E++ + + + ++ + + + R +GF F+++ Sbjct: 96 KPPHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSE 155 Query: 427 HMVDEAQNNRPHKIDGRIVEPKRAVPRE 510 VD+ + H I+G VE KRA+P+E Sbjct: 156 DTVDKICETQFHNIEGNKVEVKRALPKE 183 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +1 Query: 541 VKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSV 639 + KLFV GL + +E L+EYFS +G +V V + Sbjct: 28 IGKLFVGGLSYETTKESLKEYFSKYGELVGVDI 60 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 76.2 bits (179), Expect = 2e-14 Identities = 39/102 (38%), Positives = 61/102 (59%) Frame = +1 Query: 319 LKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 498 L++ +E++GE+ + VVM+DP TKRS+GFGF+T+ VD N+ ++DG K+ Sbjct: 124 LRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDG-----KKM 178 Query: 499 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGNI 624 V T KK+F+ GL + EED+++YFS FG + Sbjct: 179 V-----------TTTKKIFIGGLSTNTSEEDMKKYFSQFGKV 209 Score = 34.7 bits (76), Expect = 0.065 Identities = 11/28 (39%), Positives = 22/28 (78%) Frame = +1 Query: 268 TRKLFIGGLDYRTTDSSLKEFYEQWGEI 351 T+K+FIGGL T++ +K+++ Q+G++ Sbjct: 182 TKKIFIGGLSTNTSEEDMKKYFSQFGKV 209 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 69.7 bits (163), Expect = 2e-12 Identities = 30/68 (44%), Positives = 48/68 (70%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 453 KLF+GG+ Y + D +L++F+ Q+GEI + VV+KD TK+SKG+GF+T + + + A N Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKN 70 Query: 454 RPHKIDGR 477 + I+GR Sbjct: 71 KRPMIEGR 78 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 547 KLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 KLFV G+ + ++ LR++F+ FG I V+ Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFGEIREAVVI 42 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 64.5 bits (150), Expect = 7e-11 Identities = 40/115 (34%), Positives = 67/115 (58%), Gaps = 7/115 (6%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGE-----IVDVVVMKDPKTKRSKGFGFITYSQ-AHMV 435 KLF+GGL+ TT+ +++ +++ + E + V + K P+ K S+ F F+ +S + ++ Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSFCEGSEADVSSVSLAKTPEGK-SRKFCFVEFSNGSDII 67 Query: 436 DEAQNN-RPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLR 597 D N H ID + VE KRA+PR++ A KKLF+ GLK + EED++ Sbjct: 68 DNIVFNFESHSIDNKQVEVKRAMPRDD-PNELAHVRTKKLFIGGLKDEHSEEDVK 121 Score = 46.8 bits (106), Expect = 2e-05 Identities = 28/98 (28%), Positives = 52/98 (53%), Gaps = 4/98 (4%) Frame = +1 Query: 217 LNMKPSESGDDYEEPEH--TRKLFIGGLDYRTTDSSLKEFYEQWGEI--VDVVVMKDPKT 384 + +K + DD E H T+KLFIGGL ++ +K +++ +++D +T Sbjct: 84 VEVKRAMPRDDPNELAHVRTKKLFIGGLKDEHSEEDVKTALAPLSPFAPLEIKMVRDRET 143 Query: 385 KRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 498 + KG+ F+ + H+VD+ R ++ G+ VE K+A Sbjct: 144 NKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 547 KLFVAGLKQDIEEEDLREYFSTF--GNIVSVSVVT 645 KLFV GL +D EE +R YF +F G+ VS V+ Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSFCEGSEADVSSVS 43 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 63.7 bits (148), Expect = 1e-10 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 10/92 (10%) Frame = +1 Query: 379 KTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE---------- 528 + + KGFGF+T+ ++ +PH +DG+ ++PK AVPR ++ + Sbjct: 137 RARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQR 196 Query: 529 ASATVKKLFVAGLKQDIEEEDLREYFSTFGNI 624 SA K+F+ GL EEDL+EYFST+G + Sbjct: 197 GSANDGKVFIGGLAFGTTEEDLKEYFSTYGMV 228 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEI 351 K+FIGGL + TT+ LKE++ +G + Sbjct: 203 KVFIGGLAFGTTEEDLKEYFSTYGMV 228 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 58.8 bits (136), Expect = 3e-09 Identities = 45/143 (31%), Positives = 69/143 (48%), Gaps = 14/143 (9%) Frame = +1 Query: 256 EPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMV 435 +P+ +++ D +KE + G+IV + VM DP+ K SKGFGF+++ Sbjct: 104 QPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGK-SKGFGFVSFETPEEA 162 Query: 436 DEAQNNRPHK-IDGRIVEPKRAVPREEIKRPEASATVKK-------------LFVAGLKQ 573 +EA N K I GR + RA R E + E A ++K L++ L Sbjct: 163 EEAVNVLNGKEIGGRRLWAGRAKKRAE-RAAEVKAEIEKKRQERINRFQGVNLYIKNLDD 221 Query: 574 DIEEEDLREYFSTFGNIVSVSVV 642 I++E LRE FS +G I S V+ Sbjct: 222 PIDDERLREEFSPYGTISSAKVM 244 Score = 48.8 bits (111), Expect = 4e-06 Identities = 38/148 (25%), Positives = 71/148 (47%), Gaps = 7/148 (4%) Frame = +1 Query: 223 MKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGF 402 M PS +Y L++G L T++ L E + G ++ + V +D T+RS G+ Sbjct: 1 MNPSTGAANYP----IASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGY 56 Query: 403 GFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA-VPR--EEIKRPEASATVKK----LFVA 561 ++ + Q +A ++DG ++ K+ V R + +R E T K ++V Sbjct: 57 AYVNFQQPG--HDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKFTNVYVK 114 Query: 562 GLKQDIEEEDLREYFSTFGNIVSVSVVT 645 D+++E ++E + G IVS+ V+T Sbjct: 115 NFGDDMDDEQMKEICAEAGKIVSLKVMT 142 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/72 (36%), Positives = 37/72 (51%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNR 456 L+I LD D L+E + +G I VMKD K SKGFGF+ +S +A Sbjct: 214 LYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGN-SKGFGFVCFSSPEEATKAVT-- 270 Query: 457 PHKIDGRIVEPK 492 +++GRI+ K Sbjct: 271 --EMNGRILISK 280 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 54.4 bits (125), Expect = 8e-08 Identities = 33/137 (24%), Positives = 66/137 (48%), Gaps = 1/137 (0%) Frame = +1 Query: 232 SESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFI 411 S +D +P TR LF+G ++ TT LKE +E++GE++DV + K P + + F+ Sbjct: 236 SNYSEDEFDPGCTRTLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQP---GNNPYAFV 292 Query: 412 TYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASAT-VKKLFVAGLKQDIEEE 588 +++ +A+ K+D + V R +K + ++V G+ + E+ Sbjct: 293 QFAELSSAIQAR----RKMD------REYVGRNRVKVGFGKVNPINTIWVGGVTNSLSEQ 342 Query: 589 DLREYFSTFGNIVSVSV 639 + +F +G + V + Sbjct: 343 QVERHFGRYGRVTKVVI 359 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 54.4 bits (125), Expect = 8e-08 Identities = 26/81 (32%), Positives = 51/81 (62%), Gaps = 1/81 (1%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQN 450 K +IG LD++ ++ L++ + ++ ++VDV V+ D +T+R +GF F+T+ S+ +M D Sbjct: 231 KCYIGNLDFKVNEADLQDRFSRY-DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINE 289 Query: 451 NRPHKIDGRIVEPKRAVPREE 513 + DGR ++ +A RE+ Sbjct: 290 LDGQEFDGRSMKVNQARSREQ 310 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 349 IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREE 513 ++ V V+ D +T R +GFGF+T+ +D+A + +DGR ++ +A PR E Sbjct: 35 LLSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPRGE 90 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 54.0 bits (124), Expect = 1e-07 Identities = 34/127 (26%), Positives = 64/127 (50%) Frame = +1 Query: 262 EHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE 441 +++R +F+GGL T + LK+++EQ+GE+ V +M+ S+ +GF+ + E Sbjct: 77 KNSRSVFVGGLASGTDEEGLKDYFEQFGEVESVRIMR-TFLGYSRNYGFVLFKDDGPSKE 135 Query: 442 AQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGN 621 + H I+G+ V+ + S + ++V GL E+ +RE+F FG Sbjct: 136 VL-KKSHVINGKTVDVGK------------SRNFRVIYVGGLPSHFTEQTVREHFKKFGV 182 Query: 622 IVSVSVV 642 I +V + Sbjct: 183 IEAVKFI 189 Score = 48.8 bits (111), Expect = 4e-06 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 2/128 (1%) Frame = +1 Query: 268 TRKLFIGGLDYRTTDSSLKEFYEQWGEI--VDVVVMKDPKTKRSKGFGFITYSQAHMVDE 441 ++KL + LD+ TT L+E++E+ GE+ +D+++ + +T + F F V E Sbjct: 235 SKKLMVQDLDFDTTVDELREYFEKCGELTGIDLLINSEKRTCAAIVF-FRNLKDIKKVVE 293 Query: 442 AQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGN 621 H I G V + +P EE + + LFV L +D +E D+ YF +G Sbjct: 294 EN----HTIKGLKVRTVQ-LPNEE----KQGVRERTLFVDNLSEDTKELDVLRYFRPYGQ 344 Query: 622 IVSVSVVT 645 + V ++T Sbjct: 345 VAKVHILT 352 Score = 34.7 bits (76), Expect = 0.065 Identities = 19/93 (20%), Positives = 42/93 (45%) Frame = +1 Query: 217 LNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSK 396 L ++ + ++ ++ R LF+ L T + + ++ +G++ V ++ D +T +SK Sbjct: 301 LKVRTVQLPNEEKQGVRERTLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGKSK 360 Query: 397 GFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKR 495 G G + V++ H I V +R Sbjct: 361 GCGVVKLRHPGTVNKILEEPVHVIGKSQVRLRR 393 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/81 (27%), Positives = 49/81 (60%) Frame = +1 Query: 268 TRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 447 ++++F+ G + TT+S L+ F+E++G + + +++D K SKG+ FIT+ + D + Sbjct: 7 SKRIFVKGFNRETTESELRAFFEEYGVVKESKIVRD-KHGVSKGYAFITFESQEVADGLR 65 Query: 448 NNRPHKIDGRIVEPKRAVPRE 510 +N+ +++ +AV R+ Sbjct: 66 DNKGLDFKDKVLSIGQAVRRK 86 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 4/93 (4%) Frame = +1 Query: 271 RKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQ 447 R +F+G + Y ++ LKE + + G ++ ++ D +T + KG+GF Y Q + + Sbjct: 25 RSVFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQETALSAMR 84 Query: 448 NNRPHKIDGRIVEPKRAVP---REEIKRPEASA 537 N ++++GR + A +EEIK E +A Sbjct: 85 NLNGYELNGRALRVDSAASEKNKEEIKSMEMTA 117 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 48.8 bits (111), Expect = 4e-06 Identities = 32/118 (27%), Positives = 62/118 (52%), Gaps = 1/118 (0%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNN 453 +++GGLD + +++ + E + Q G +V+V + KD T+ +G+GF+ + D A + Sbjct: 15 IYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVM 74 Query: 454 RPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGNIV 627 K+ G+ + +A K + A LF+ L +++E+ L + FS FG I+ Sbjct: 75 NMIKVYGKPIRVNKASAHN--KNLDVGA---NLFIGNLDTEVDEKLLYDTFSAFGVIL 127 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVV-VMKDPKTKRSKGFGFITYSQAHMVDEA 444 LFIG LD + L + + +G I+ +M+D T SKGF FI ++ D A Sbjct: 102 LFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAA 158 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 48.4 bits (110), Expect = 5e-06 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 453 + +IG L Y + +L+E + ++VDV V+ D +T R +GFGF+T+ +++A + Sbjct: 6 RCYIGNLSYSVDEQALEEKFHGC-DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAIDE 64 Query: 454 -RPHKIDGRIVEPKRAVPREE 513 DGR ++ +A PR E Sbjct: 65 FDGQDFDGRPMKVNQAQPRGE 85 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 48.4 bits (110), Expect = 5e-06 Identities = 19/64 (29%), Positives = 38/64 (59%) Frame = +1 Query: 253 EEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHM 432 ++P +L++G L + T++ +K +E +G + V ++ D +T RSKG+GF+ + +A Sbjct: 236 KQPLGPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEA 295 Query: 433 VDEA 444 A Sbjct: 296 AKRA 299 Score = 47.6 bits (108), Expect = 9e-06 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 8/146 (5%) Frame = +1 Query: 229 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGF 408 P ++ E + R +F L L+EF+ + G++ DV ++ D ++RSKG + Sbjct: 132 PEPMTEESAEEKDQRTVFCMQLARNIRPRDLEEFFSKVGQVSDVRIISDRNSRRSKGIAY 191 Query: 409 ITYSQAHMVDEAQNNRPHKIDGRIV-------EPKR-AVPREEIKRPEASATVKKLFVAG 564 I ++ V A K+ G + E R A E +K+P +L+V Sbjct: 192 IEFTDKSAVPLAIGLSGQKLLGAPIMVMLTQAEKNRLAAEAERLKQPLGPT---RLYVGS 248 Query: 565 LKQDIEEEDLREYFSTFGNIVSVSVV 642 L +I E ++ F FG + SV ++ Sbjct: 249 LHFNITEAMVKAVFEPFGTVDSVQLI 274 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 48.0 bits (109), Expect = 7e-06 Identities = 33/123 (26%), Positives = 54/123 (43%) Frame = +1 Query: 271 RKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 450 R +F+G L T +S++ E++ GE V+ V + +SKGF F+ + V+ Sbjct: 42 RTIFVGSLHPSTVESTIFEYFSTLGEQVEHVKCIRTLSGKSKGFAFVRLRKKEAVESVLG 101 Query: 451 NRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGNIVS 630 H ID V E T +K+ + + I E + E+FS+ G I S Sbjct: 102 RDDHVIDNSDVS------------MEKQDTYRKVILKNIPSSIGESQILEHFSSSGEIAS 149 Query: 631 VSV 639 V + Sbjct: 150 VYI 152 Score = 41.5 bits (93), Expect = 6e-04 Identities = 28/129 (21%), Positives = 57/129 (44%) Frame = +1 Query: 253 EEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHM 432 E+ + RK+ + + +S + E + GEI V + ++ KTK KG +T++ Sbjct: 115 EKQDTYRKVILKNIPSSIGESQILEHFSSSGEIASVYIPENLKTKERKGHCIVTFASVTE 174 Query: 433 VDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFST 612 E R H I G + + + +K+P KKL + L ++ + ++ Sbjct: 175 AFEVVKKRKHHIHGYDIITEYYM---NLKQP------KKLCLKNLPYNVTVDQIKNRMDG 225 Query: 613 FGNIVSVSV 639 FG ++ + + Sbjct: 226 FGGLMEIDL 234 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 47.6 bits (108), Expect = 9e-06 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 8/130 (6%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITY---SQAHMVDEA 444 ++++G +++ + ++ + +G I + + DP + KGF F+ Y A + E Sbjct: 103 RVYVGSINFELREEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQ 162 Query: 445 QN-----NRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFS 609 N R K+ GR +A P E EA ++++A + D+ E+D++ F Sbjct: 163 MNGVLLGGRNIKV-GRPSNVPQAAPLIEQFEQEAK-KYARIYIASVHPDLLEDDIKSVFE 220 Query: 610 TFGNIVSVSV 639 FG +V S+ Sbjct: 221 AFGKVVHCSL 230 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/64 (25%), Positives = 34/64 (53%) Frame = +1 Query: 253 EEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHM 432 +E + +++I + + +K +E +G++V + K+P T + KG+GFI Y Sbjct: 193 QEAKKYARIYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQS 252 Query: 433 VDEA 444 ++A Sbjct: 253 ANDA 256 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 47.6 bits (108), Expect = 9e-06 Identities = 36/145 (24%), Positives = 70/145 (48%), Gaps = 2/145 (1%) Frame = +1 Query: 214 ILNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRS 393 I N +P E+G E L I + + +K+ + G + +++D T +S Sbjct: 12 INNHEPMENGTSDERTN----LIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQS 67 Query: 394 KGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKK--LFVAGL 567 G+ F+ Y D+A N +++G ++ K + RP +S +K L+++GL Sbjct: 68 LGYAFVNYDNP---DDA-NKAVREMNGARLQNKTL--KVSFARP-SSTEIKNANLYISGL 120 Query: 568 KQDIEEEDLREYFSTFGNIVSVSVV 642 +D++EE++ F FG I++ V+ Sbjct: 121 PKDMKEEEVEALFKPFGKIITSKVL 145 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 47.2 bits (107), Expect = 1e-05 Identities = 33/133 (24%), Positives = 56/133 (42%) Frame = +1 Query: 244 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQ 423 D EE L+I GL TTD L ++G I+ + D T KG+GF+ + Sbjct: 91 DTGEEKLSKTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFES 150 Query: 424 AHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREY 603 +A +V + + + K+ E T L++ L Q+ +E L Sbjct: 151 PISAQKAV--------AALV--NKGIQAQMAKQQEQDPT--NLYIQNLPQNCDEAMLENM 198 Query: 604 FSTFGNIVSVSVV 642 FS +G ++S ++ Sbjct: 199 FSKYGKVISTRIL 211 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/82 (26%), Positives = 47/82 (57%), Gaps = 1/82 (1%) Frame = +1 Query: 271 RKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-Q 447 RKL+IG L++ + + +++ +E++G + V +++D ++ RS+GFGF+ A + A + Sbjct: 9 RKLYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQIAPAIE 67 Query: 448 NNRPHKIDGRIVEPKRAVPREE 513 + GR + A+ + E Sbjct: 68 KMNQSSVGGRNITVALALDKTE 89 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 46.4 bits (105), Expect = 2e-05 Identities = 16/47 (34%), Positives = 33/47 (70%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITY 417 +++G L Y T+S L + +E++G++V V +++D +T+ S+G FI + Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRESRGVAFILF 58 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 46.0 bits (104), Expect = 3e-05 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 5/126 (3%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ--- 447 LF+G L + T++ + +G I + +++ T SKG+GF+ Y+ +A+ Sbjct: 115 LFVGNLPFEFTETQFGDLMSPYGNIERLFLVRSEVTGDSKGYGFVEYATRENAMQAKQQL 174 Query: 448 -NNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDL-REYFSTFGN 621 N I GRI+ R E A + LFV L +D + L +E FS GN Sbjct: 175 LNTASKYIGGRIL---RVAFAESNLLTYADVHSRTLFVDRLPRDFKNGGLIKELFSQTGN 231 Query: 622 IVSVSV 639 + V Sbjct: 232 VTFAQV 237 Score = 37.5 bits (83), Expect = 0.009 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +1 Query: 265 HTRKLFIGGLDYRTTDSSL-KEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE 441 H+R LF+ L + L KE + Q G + V +P S+GF F+ Y+ A ++ Sbjct: 203 HSRTLFVDRLPRDFKNGGLIKELFSQTGNVTFAQVAINPANGGSRGFAFVDYATAEEAEK 262 Query: 442 AQNNRPHKIDGRIVE 486 Q R H +GR VE Sbjct: 263 GQ--RAH--NGRQVE 273 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 45.2 bits (102), Expect = 5e-05 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 2/86 (2%) Frame = +1 Query: 262 EHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE 441 +H R +FIG L + + L+E + G + V +++D KT KGFG++ + V Sbjct: 53 DHQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVF 112 Query: 442 AQNNRPHKIDGRIVE--PKRAVPREE 513 A + GR + P + P+ E Sbjct: 113 ALKMNNAEFKGRKIRVFPSKDKPQTE 138 Score = 41.5 bits (93), Expect = 6e-04 Identities = 25/80 (31%), Positives = 40/80 (50%) Frame = +1 Query: 403 GFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIE 582 G++ Y A ++A + +IDG + A +A + +F+ L DIE Sbjct: 15 GYVVYKAAENANQAIASNGEEIDGFHIRVDLA------SNDKAHDHQRSVFIGNLPFDIE 68 Query: 583 EEDLREYFSTFGNIVSVSVV 642 EE LRE F+T GN+ SV ++ Sbjct: 69 EEPLRELFTTCGNVESVRLI 88 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/58 (29%), Positives = 35/58 (60%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 450 L + L YRTT LK+ ++++G++ D+ + +D T S+GF F+ + + ++A + Sbjct: 18 LKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAMD 75 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/50 (38%), Positives = 33/50 (66%) Frame = +1 Query: 361 VVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 510 ++M D T+R +GFGF+T+ + D+A + + H I+ + VE K+A P+E Sbjct: 1 MLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 50 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 4/107 (3%) Frame = +1 Query: 259 PEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD 438 P+ K+FIGGL + +KE +GE+ ++KD T SKG+ F Y + D Sbjct: 669 PDSPHKIFIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAFCEYVDLGITD 728 Query: 439 EAQN--NRPHKIDGRIVEPKRAV-PREEIKRPEASATV-KKLFVAGL 567 A N D +++ + +V ++ + P+A V +L + GL Sbjct: 729 VAIQGLNGMQLGDKKLIVQRASVGAKQNLNNPQAMNMVPAQLQIPGL 775 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +1 Query: 547 KLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 K+F+ GL + E+ ++E S+FG + + ++V Sbjct: 674 KIFIGGLPNYLNEDQVKELLSSFGELRAFNLV 705 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 43.6 bits (98), Expect = 1e-04 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 2/83 (2%) Frame = +1 Query: 250 YEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAH 429 ++E R ++I SSL+ + +G I D+ +++ +T +SKGFG++TY A Sbjct: 56 HKEEHDQRTIYIRDFRPDIRKSSLESVFGPYGAIEDLSIIRT-QTGKSKGFGYVTYENAE 114 Query: 430 MVDEAQNNRPHKIDGR--IVEPK 492 A H IDG+ I EPK Sbjct: 115 SAQRALAG-THIIDGKWVIAEPK 136 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 42.7 bits (96), Expect = 2e-04 Identities = 28/84 (33%), Positives = 45/84 (53%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNR 456 LFI L TD+ L + ++ +G ++ V D +T SK FGF++Y V AQN Sbjct: 279 LFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDN---VMSAQNAI 335 Query: 457 PHKIDGRIVEPKRAVPREEIKRPE 528 H ++G + KR + ++KRP+ Sbjct: 336 QH-MNGFQIGAKRL--KVQLKRPK 356 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 550 LFVAGLKQDIEEEDLREYFSTFGNIVSVSV 639 LF+ L Q+ + DL + F FG ++S V Sbjct: 279 LFIYHLPQEFTDADLMQTFQPFGTVISAKV 308 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 42.7 bits (96), Expect = 2e-04 Identities = 33/116 (28%), Positives = 55/116 (47%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 453 ++FIG + + L +E+ G I D +M DP + +KGF F T+S DEAQ N Sbjct: 153 QVFIGKVPRDCFEDELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTFSNK---DEAQ-N 208 Query: 454 RPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGN 621 K+D + + P + + S +LFV + + ++++ E FS N Sbjct: 209 AVKKLDNKEIRPGKRL------GVCISVANSRLFVGSIPKTKSKQEILEEFSKVTN 258 Score = 31.5 bits (68), Expect = 0.61 Identities = 21/94 (22%), Positives = 43/94 (45%), Gaps = 1/94 (1%) Frame = +1 Query: 229 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGF 408 P E DD + + + +++ L T+ LKE Y Q+G + + K+ K + F Sbjct: 316 PQEEPDD-DAMKKVKVVYLRNLSPSITEEKLKEEYSQYGAV--------DRVKKLKDYAF 366 Query: 409 ITYSQA-HMVDEAQNNRPHKIDGRIVEPKRAVPR 507 + +++ H + + ++DG +E A P+ Sbjct: 367 VHFTERDHALKAIEETDGKEMDGLKIEASLAKPQ 400 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 41.9 bits (94), Expect = 4e-04 Identities = 25/94 (26%), Positives = 46/94 (48%), Gaps = 1/94 (1%) Frame = +1 Query: 214 ILNMKPSESGDDYEEPEHTRKLF-IGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKR 390 I K S D+++ +LF I D+ D L+ +E +G+I V +++D KT+ Sbjct: 35 IAQSKHSGGKSDFQDQTTMTRLFVICPKDFN--DEDLRSKFESFGDIEYVQIVRDHKTRE 92 Query: 391 SKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPK 492 +KG+G++ + ++ A N + EPK Sbjct: 93 NKGYGYVKFHKSSTAAMALENCDKSLKAVWAEPK 126 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +1 Query: 538 TVKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 T+ +LFV K D +EDLR F +FG+I V +V Sbjct: 52 TMTRLFVICPK-DFNDEDLRSKFESFGDIEYVQIV 85 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +1 Query: 247 DYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFIT 414 D E EH + +IG L Y + +L+E + +VDV V+ D +T R +GFGF+T Sbjct: 76 DLEMAEH--RCYIGNLSYSVDEQALEEKFHDCN-VVDVRVITDRETGRPRGFGFVT 128 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 41.1 bits (92), Expect = 7e-04 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 5/96 (5%) Frame = +1 Query: 235 ESGDDYEEPEHTRK--LFIGGLDYRTTDSSLKEFYEQWGEIVDVVV--MKDPKTKRSKGF 402 ES D P+ ++K L I L + T++ LKE + +GE+ + V K + R GF Sbjct: 233 ESKDKSSSPKGSKKSRLIIRNLAFNCTEAILKETFSAFGEVSEASVPQKKVGRRNRKMGF 292 Query: 403 GFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 507 GF+ ++ +A + KI GR V AVP+ Sbjct: 293 GFVQFTNVFDAAKALEEMNAKKILGRPVAVDWAVPK 328 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/73 (26%), Positives = 35/73 (47%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNR 456 +FI L + +T ++ ++Q+G+I V+ D T+ SKG F+ Y A V + Sbjct: 418 VFIRNLSFDSTQKNITNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAAT 477 Query: 457 PHKIDGRIVEPKR 495 +G ++ R Sbjct: 478 DEDSEGLFLDGNR 490 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTK-RSKGFGFITYSQAHMVDEAQNN 453 +F+ L Y TD+ K +E+ G + ++KD + R +GFG++T++ +A++N Sbjct: 22 IFVRNLPYNITDAEFKSAFEEIGPLKRGFIVKDKDNQNRCRGFGYVTFALEEDALKAKDN 81 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/76 (34%), Positives = 46/76 (60%), Gaps = 2/76 (2%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNR 456 ++IGGL T++ L E + ++G + DVV+++D ++ +S+ GF+ + + V EA N Sbjct: 526 VWIGGLSEDVTENVLLELFNKFGPVKDVVILRD-ESGKSRQSGFVHFWSSD-VAEAANVG 583 Query: 457 PHKID--GRIVEPKRA 498 + D G+IVE K A Sbjct: 584 MNGCDILGKIVETKYA 599 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 39.5 bits (88), Expect = 0.002 Identities = 14/48 (29%), Positives = 29/48 (60%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITY 417 ++F G L TD SL + ++ + +++D K+ +SKG+GF+++ Sbjct: 218 RIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSF 265 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/68 (32%), Positives = 32/68 (47%) Frame = +1 Query: 244 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQ 423 DD T + + L T +S L+E + G I + + KD T +SKGF FI + Sbjct: 172 DDGSGQHETATIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINF-- 229 Query: 424 AHMVDEAQ 447 H D A+ Sbjct: 230 VHREDAAR 237 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 9/87 (10%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWG-EIVDVVVMKDPKTK-------RSKGFGFITYSQAH 429 K++ G L ++ T LK +E + DV+++K+P+ + RS+GFGF+T++ Sbjct: 51 KVYAGNLPFKLTQDELKAVFEAESLTVTDVLIVKEPRNEFYQQQEPRSRGFGFVTFANPE 110 Query: 430 MVDEAQNNRPHK-IDGRIVEPKRAVPR 507 A + K + GR ++ ++ R Sbjct: 111 DAQTAVKSLNGKEVQGRTLKIAPSISR 137 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +1 Query: 271 RKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-Q 447 R ++GGL + L + +G+I DV + D T + +GFGF+ + A A Sbjct: 5 RVAYVGGLAEEVDEKVLHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAEDTAAAID 64 Query: 448 NNRPHKIDGRIVEPKRAVP 504 N ++ GR + A P Sbjct: 65 NMNESELFGRTIRVNLAKP 83 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 37.5 bits (83), Expect = 0.009 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 1/125 (0%) Frame = +1 Query: 253 EEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHM 432 E+P+ TR LF+G L+ + L+ +E++G ++DV + K P + + F+ ++ + Sbjct: 231 EDPKATRTLFVGNLETGISCQDLRLSFEKFGVVLDVDI-KRPARGQGNTYAFVKFADLDV 289 Query: 433 VDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEA-SATVKKLFVAGLKQDIEEEDLREYFS 609 +A + + + R IK S +L+V GL I +L F Sbjct: 290 AAKA----------KCAMQGQCIGRNHIKIGYGRSQQTTRLWVGGLGPWISIPELEREFD 339 Query: 610 TFGNI 624 FG I Sbjct: 340 RFGAI 344 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 502 PREEIKRPEASA-TVKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSV 639 P++E PE + LFV L+ I +DLR F FG ++ V + Sbjct: 222 PQQEYIPPEEDPKATRTLFVGNLETGISCQDLRLSFEKFGVVLDVDI 268 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 37.5 bits (83), Expect = 0.009 Identities = 12/48 (25%), Positives = 32/48 (66%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYS 420 +++G + + ++ +K+F+EQ+G + + + + K+ RSKG+ F+ ++ Sbjct: 100 IYLGHIPHGFFENEIKKFFEQFGTVNRIRLSRSKKSARSKGYAFVEFA 147 >SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) Length = 166 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 367 MKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 501 +KD K+ RSK +GF+ + ++A N+PH I+G+ P V Sbjct: 94 VKDLKSGRSKKYGFVFFKDEEACEKAMGNQPHFIEGQKSGPSSPV 138 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 36.7 bits (81), Expect = 0.016 Identities = 23/83 (27%), Positives = 43/83 (51%) Frame = +1 Query: 247 DYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQA 426 D + P++ LF+ L+ TTD L+ + ++G I+ V++D KT S + FI + + Sbjct: 114 DIKPPDNV--LFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYAFIEFEK- 170 Query: 427 HMVDEAQNNRPHKIDGRIVEPKR 495 DE K+D +++ +R Sbjct: 171 ---DEDCERAYFKMDNVLIDDRR 190 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +1 Query: 499 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 +P +IK P+ LFV L +EDL FS FG I+S V+ Sbjct: 110 IPDADIKPPD-----NVLFVCKLNPVTTDEDLEIIFSRFGTILSCEVI 152 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +1 Query: 250 YEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKG 399 Y+ + K+F+G + ++ LK+F+ +G++V ++ D KRSKG Sbjct: 72 YKVVSNKCKVFVGNIGFKVRARELKDFFGYFGDVVYAQIIMDRVKKRSKG 121 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 36.3 bits (80), Expect = 0.021 Identities = 26/106 (24%), Positives = 51/106 (48%), Gaps = 11/106 (10%) Frame = +1 Query: 355 DVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEIKRP-- 525 +V V+KDP +SKGFGF+++ + +A I G+ V+ A + + Sbjct: 541 EVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQTKP 600 Query: 526 --------EASATVKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSV 639 ++S ++V L D+++ +L++ FS +G+I+ V Sbjct: 601 LVWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSILETKV 646 Score = 33.9 bits (74), Expect = 0.11 Identities = 28/126 (22%), Positives = 54/126 (42%), Gaps = 1/126 (0%) Frame = +1 Query: 250 YEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGF-GFITYSQA 426 Y E R L++G LD + T + + + ++V ++ P K F F T++ A Sbjct: 362 YFPEEENRSLYVGNLDPKCTQELICSIFNKIAKVVRCKMINSPTDKGPYCFVEFETHADA 421 Query: 427 HMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYF 606 + R + + ++ A +KR + + +FV L ++++ LR+ F Sbjct: 422 QEAKFRMDQRT--VMDKKLKVNWATNHPGMKRGDTNNHFH-IFVGDLAENVDNALLRKTF 478 Query: 607 STFGNI 624 FG I Sbjct: 479 EPFGEI 484 >SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 35.9 bits (79), Expect = 0.028 Identities = 22/107 (20%), Positives = 53/107 (49%), Gaps = 1/107 (0%) Frame = +1 Query: 229 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGF 408 P+++ ++ E + L++ L T + LK + Q+G++V ++ + K ++ FG Sbjct: 335 PAKATPTKDKKEGGKSLWVANLSSITRAADLKTRFSQYGKVVGAKIVTNSKAPGAQCFGL 394 Query: 409 ITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEIKRPEASATVK 546 +T + + + Q+ ++ GR + RA + + + + SA+ K Sbjct: 395 VTMTTSEEAAKCIQHLHRTELHGRAITVDRA-KGDRVSQTQGSASKK 440 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 487 PKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSVVT 645 P +A P + + K L+VA L DL+ FS +G +V +VT Sbjct: 330 PAKATPAKATPTKDKKEGGKSLWVANLSSITRAADLKTRFSQYGKVVGAKIVT 382 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 35.9 bits (79), Expect = 0.028 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +1 Query: 538 TVKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 ++ L+V GL+ + E+DLR++F FG + S+S+V Sbjct: 302 SITTLYVGGLEGKVTEQDLRDHFYQFGELRSISMV 336 Score = 28.7 bits (61), Expect = 4.3 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEI 351 L++GGL+ + T+ L++ + Q+GE+ Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGEL 330 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 35.5 bits (78), Expect = 0.037 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 1/93 (1%) Frame = +1 Query: 238 SGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITY 417 SG + P ++ L + L Y TT SL +E + V+ D ++ S+GFGF+ Y Sbjct: 279 SGGRDQNPPNS-SLIVRNLSYDTTTDSLGAAFEGCS---NAKVIFDRESGESRGFGFVDY 334 Query: 418 SQAHMVDEAQNNRP-HKIDGRIVEPKRAVPREE 513 + + ++DGR V A PR E Sbjct: 335 DDVETAKKVLSEMAGAEVDGRQVRLDFASPRTE 367 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 35.5 bits (78), Expect = 0.037 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 232 SESGD-DYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGF 408 S SG D + P +R + + D ++ +EQ+G I DV V+KD TK ++G + Sbjct: 11 SNSGRIDVDNPPFSRVFIVCSKRHNAED--IRSAFEQYGTIEDVWVVKDKATKENRGVCY 68 Query: 409 ITYSQA 426 + + +A Sbjct: 69 VKFVKA 74 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 35.5 bits (78), Expect = 0.037 Identities = 29/116 (25%), Positives = 56/116 (48%) Frame = +1 Query: 262 EHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE 441 E ++FIG + + L E+ GEI + + DP T +KGF F T+++ + Sbjct: 150 ESGTEVFIGKIPRDCLEDELIPLLEKCGEIREFRLQMDPATGLNKGFAFCTFTEQTSAYQ 209 Query: 442 AQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFS 609 A ++ + + P R R I + +++ +LFV G+ + +E++ + FS Sbjct: 210 AITT----LNDKDIRPGR---RLAICKSRSNS---RLFVKGIPKRKSKEEIFQEFS 255 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 34.7 bits (76), Expect = 0.065 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 340 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 483 +GEIV+V +++D KT + KGF F+ Y Q + N K+ GR + Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDNFNGIKLGGRTI 50 >SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1148 Score = 34.3 bits (75), Expect = 0.086 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = +1 Query: 253 EEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHM 432 E+PE R +FIGGL + + E + GEI + + K K + ++ F + + Sbjct: 345 EKPEGCRTVFIGGLPESINEHIINEIFYVCGEITSIRISKG-KGENARKFCHLRFGAKES 403 Query: 433 VDEA 444 VD A Sbjct: 404 VDTA 407 >SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) Length = 260 Score = 33.9 bits (74), Expect = 0.11 Identities = 28/113 (24%), Positives = 51/113 (45%), Gaps = 16/113 (14%) Frame = +1 Query: 229 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVM------------- 369 PS D P ++L + + +R D+ L++ + +G I DV ++ Sbjct: 57 PSAENGDSSGP---KRLHVTNIPFRFRDNDLRQMFGSFGVIADVEIIYNERGSKHAVRFP 113 Query: 370 --KDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKRAVPREEIK 519 +P R +GFGF+T++ A ++A+ I DGR VE + + I+ Sbjct: 114 TRPNPLNLRIEGFGFVTFNTAAEANKAREKLNGTIVDGRKVEVSLCMEQSYIR 166 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 532 SATVKKLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 S+ K+L V + + DLR+ F +FG I V ++ Sbjct: 64 SSGPKRLHVTNIPFRFRDNDLRQMFGSFGVIADVEII 100 >SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 462 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITY 417 +F+ LDY+ LK+ ++ G ++ +M+D + K+SKG G + + Sbjct: 187 VFVTNLDYKVNWQKLKDTFKCAGHVIRAEIMEDDE-KKSKGMGTVQF 232 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +1 Query: 544 KKLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 +KLFV + + +EEDLR FS FG I ++V+ Sbjct: 214 RKLFVGMISKHAKEEDLRVMFSPFGTIEELTVL 246 Score = 31.1 bits (67), Expect = 0.80 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSK 396 KLF+G + + L+ +E +G+I ++ ++KD T + K Sbjct: 171 KLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHK 211 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 547 KLFVAGLKQDIEEEDLREYFSTFGNIVSVSVV 642 KLFV + + EE+DLR F +G I ++++ Sbjct: 171 KLFVGQVPRTWEEKDLRPIFEPYGQIYELTIL 202 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 340 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 453 +GEIV+V +++D KT + KGF F+ Y A +N Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDN 39 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 358 VVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 507 V ++ D +T R +GFGF+T+ +++A + +DGR ++ A PR Sbjct: 125 VNIITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEAKPR 175 >SB_44858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 32.3 bits (70), Expect = 0.35 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +1 Query: 484 EPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLREYFS 609 EPKR + + R E T KK A KQD EEE+L+ +F+ Sbjct: 401 EPKRKTGKPLMFRSEPPQTRKKQQDADKKQDKEEEELKYFFT 442 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 89 LSKLPMQAAFTPRADSCSPGDPLV 18 LSKLP ++SCSPGDPLV Sbjct: 50 LSKLPNNLFIITTSNSCSPGDPLV 73 >SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 129 IKYSVSFLSLITSTFQVADASSVHASCRFLQPGGSTS 19 I ++ +++L+ +HAS FLQPGGSTS Sbjct: 9 ISANIQYMNLVHRKRGAEKPFRIHASIEFLQPGGSTS 45 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.9 bits (69), Expect = 0.46 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFI 411 +LF+G L + +KE ++++GE+ +V + K+ KGFGFI Sbjct: 54 RLFVGNL-IDCDEEEMKEMFKKYGEVAEVFINKE------KGFGFI 92 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 77 PMQAAFTPRADSCSPGDPLV 18 PMQ A ++SCSPGDPLV Sbjct: 29 PMQHAIPALSNSCSPGDPLV 48 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFG 405 LFI L TD+ L + ++ +G ++ V D +T SK FG Sbjct: 231 LFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFG 273 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 550 LFVAGLKQDIEEEDLREYFSTFGNIVSVSV 639 LF+ L Q+ + DL + F FG ++S V Sbjct: 231 LFIYHLPQEFTDADLMQTFQPFGTVISAKV 260 >SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 31.1 bits (67), Expect = 0.80 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 5/69 (7%) Frame = +1 Query: 349 IVDVVVMKDPKTKRSKGFGFI---TYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPREE 513 I D+ ++KD T S+GF F+ T +A + E A N P IDGR++ A E Sbjct: 436 IYDIRLIKDKVTGTSRGFCFVELATIEEATQLLELIAAMNPPFMIDGRVITTLYARKSEP 495 Query: 514 IKRPEASAT 540 P +T Sbjct: 496 SPVPTTKST 504 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/78 (20%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +1 Query: 274 KLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 453 KL++ L ++E + +G + V + D S+GF ++ Y ++A + Sbjct: 1158 KLYVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKALKH 1217 Query: 454 RP-HKIDGRIVEPKRAVP 504 +IDG+ + + +P Sbjct: 1218 MDGGQIDGQEIAVQSVLP 1235 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 547 KLFVAGLKQDIEEEDLREYFSTFGNIVSVSV 639 +++V L QD+ E+DL + F +G+I V + Sbjct: 262 RVYVGNLPQDVREKDLHDIFYKYGHIADVDL 292 >SB_19477| Best HMM Match : GST_C (HMM E-Value=0.64) Length = 1294 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -1 Query: 624 NISKCTKILSQVFFFNVLLQSSYKQLFN-GGTSFWSFNLFPWNCSFWLDNSSVNF 463 N KCT I+ + FF VLLQ+ Q F TS WS +LF S L+ + + F Sbjct: 1073 NRVKCTVIVRIMNFFTVLLQAYPDQGFKIVPTSLWSDDLFTVVFSCALEPALIGF 1127 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 62 FTPRADSCSPGDPLV 18 F P ++SCSPGDPLV Sbjct: 138 FAPSSNSCSPGDPLV 152 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 PR++SCSPGDPLV Sbjct: 2 PRSNSCSPGDPLV 14 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 PR++SCSPGDPLV Sbjct: 21 PRSNSCSPGDPLV 33 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 PR++SCSPGDPLV Sbjct: 68 PRSNSCSPGDPLV 80 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 PR++SCSPGDPLV Sbjct: 16 PRSNSCSPGDPLV 28 >SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Frame = +1 Query: 271 RKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVM---KDPKTKRSKGFGFITYSQAHMVDE 441 RKL+IG LD R ++ ++ + +Q+GEI + P +G+ F+ + + + Sbjct: 387 RKLWIGNLDKRLSEFNILKILQQFGEIEHFQFLFHGNGPNRGEPRGYCFVEFKKKEDARK 446 Query: 442 AQNNRPHKI 468 A KI Sbjct: 447 ALRGLNKKI 455 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 544 KKLFVAGLKQDIEEEDLREYFSTFGNI 624 +K+FV GL DI+E+++ F FG++ Sbjct: 344 RKVFVGGLPPDIDEDEIHASFCRFGSL 370 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 59 TPRADSCSPGDPLV 18 TP ++SCSPGDPLV Sbjct: 14 TPTSNSCSPGDPLV 27 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +2 Query: 17 KLVDPPGCRNR-HEA*TLLASATWK 88 +LVDPPGCRN HEA L + T++ Sbjct: 14 ELVDPPGCRNSIHEAAALDGAGTFQ 38 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 62 FTPRADSCSPGDPLV 18 F P ++SCSPGDPLV Sbjct: 44 FKPTSNSCSPGDPLV 58 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 83 KLPMQAAFTPRADSCSPGDPLV 18 +LP A R++SCSPGDPLV Sbjct: 6 QLPTLAGSPFRSNSCSPGDPLV 27 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 550 LFVAGLKQDIEEEDLREYFSTFGNIVSVSV 639 LFV + ++ +E+D+ E FS +G I ++ V Sbjct: 295 LFVTNIHEEAQEDDIHELFSDYGEIKNLHV 324 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFI---TYSQAHMVDEAQ 447 LF+ + + + E + +GEI ++ V D +T KG+ + T+ +A EA Sbjct: 295 LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEAL 354 Query: 448 N 450 N Sbjct: 355 N 355 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 253 EEPEHT-RKLFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSK 396 E+PE R +F+G L +LK+++ ++GE+ V K + +K Sbjct: 14 EDPERLDRTVFVGNLPLTLKKKALKKYFSKYGEVESVRFRSATKMESTK 62 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 77 PMQAAFTPRADSCSPGDPLV 18 P + + R++SCSPGDPLV Sbjct: 867 PPETSTVKRSNSCSPGDPLV 886 >SB_35731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 132 SIKYSVSFLSLITSTFQVADASSVHASCRFLQPGGSTS 19 S+K S L+ + S V+ + FLQPGGSTS Sbjct: 146 SLKMSDDIAQLLRIRILLKTLSKVNRNIEFLQPGGSTS 183 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -2 Query: 98 SPLLSKLPMQAAFTPRADSCSPGDPLV 18 SP+L KL +Q ++SCSPGDPLV Sbjct: 18 SPVLLKLVLQGL----SNSCSPGDPLV 40 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 129 IKYSVSFLSLITSTFQVADASSVHASCRFLQPGGSTS 19 I +++ + IT T V +V + FLQPGGSTS Sbjct: 76 ITITITVIITITITITVIITITVIITIEFLQPGGSTS 112 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 68 AAFTPRADSCSPGDPLV 18 A+ T R++SCSPGDPLV Sbjct: 10 ASRTLRSNSCSPGDPLV 26 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 92 LLSKLPMQAAFTPRADSCSPGDPLV 18 +L+ P++ ++SCSPGDPLV Sbjct: 11 VLTPAPVERQHVAASNSCSPGDPLV 35 >SB_23411| Best HMM Match : Glyco_transf_8 (HMM E-Value=8.4e-15) Length = 582 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/68 (26%), Positives = 33/68 (48%) Frame = +1 Query: 283 IGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH 462 I GL ++S+ +++ EI V + KT+ G +T+ + V +NRPH Sbjct: 11 IKGLPSEVPENSIVSYFQD-SEIGGGAVKRLDKTQ--DGCTLVTFENSEAVKTFMSNRPH 67 Query: 463 KIDGRIVE 486 +G ++E Sbjct: 68 HFNGVLLE 75 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 62 FTPRADSCSPGDPLV 18 F R++SCSPGDPLV Sbjct: 2 FVVRSNSCSPGDPLV 16 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +1 Query: 277 LFIGGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 450 L++ + Y + + Q G + V +M D + ++ KGF F+T + +EAQN Sbjct: 277 LYVYNIGYDANQEGITALFGQCGIVNKVDIMWDWQRQQCKGFCFVTMATQ---EEAQN 331 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 28.7 bits (61), Expect = 4.3 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = +1 Query: 355 DVVVMKDPKTKRSKGFGFITY 417 +V+V+ D +T+RS+ FG++T+ Sbjct: 4 EVIVVYDRETRRSRNFGYVTF 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 17 KLVDPPGCRNRHEA*TLLAS 76 +LVDPPGCRN + LL+S Sbjct: 14 ELVDPPGCRNSMDDIALLSS 33 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 71 QAAFTPRADSCSPGDPLV 18 Q + T ++SCSPGDPLV Sbjct: 32 QLSITSTSNSCSPGDPLV 49 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 62 FTPRADSCSPGDPLV 18 FT ++SCSPGDPLV Sbjct: 11 FTDPSNSCSPGDPLV 25 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P+++SCSPGDPLV Sbjct: 30 PQSNSCSPGDPLV 42 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 68 AAFTPRADSCSPGDPLV 18 A+F ++SCSPGDPLV Sbjct: 9 ASFLSSSNSCSPGDPLV 25 >SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 108 LSLITSTFQVADASSV--HASCRFLQPGGSTS 19 ++ +TS ++ S + H S FLQPGGSTS Sbjct: 92 MAAMTSASGISSPSLIRRHVSIEFLQPGGSTS 123 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 98 SPLLSKLPMQAAFTPRADSCSPGDPLV 18 SP S + + P ++SCSPGDPLV Sbjct: 4 SPPPSPPLKKPGYGPASNSCSPGDPLV 30 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = -2 Query: 86 SKLPMQ--AAFTPR-ADSCSPGDPLV 18 SKLP +A P ++SCSPGDPLV Sbjct: 148 SKLPQHRVSALPPHLSNSCSPGDPLV 173 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 92 LLSKLPMQAAFTPRADSCSPGDPLV 18 +LS LP+ R++SCSPGDPLV Sbjct: 5 VLSFLPLPCL---RSNSCSPGDPLV 26 >SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 105 SLITSTFQVADASSVHASCRFLQPGGSTS 19 ++ + ++ D V S FLQPGGSTS Sbjct: 12 NITKESIKIRDIKQVIRSIEFLQPGGSTS 40 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 83 KLPMQAAFTPRADSCSPGDPLV 18 K+ A +++SCSPGDPLV Sbjct: 4 KVGFTCALPQKSNSCSPGDPLV 25 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 77 PMQAAFTPRADSCSPGDPLV 18 P+ R++SCSPGDPLV Sbjct: 51 PVVGMLPRRSNSCSPGDPLV 70 >SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 75 DASSVHASCRFLQPGGSTS 19 + S +H FLQPGGSTS Sbjct: 30 EVSHIHRHIEFLQPGGSTS 48 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 74 MQAAFTPRADSCSPGDPLV 18 M+ R++SCSPGDPLV Sbjct: 1 MEVVSFARSNSCSPGDPLV 19 >SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 544 KKLFVAGLKQDIEEEDLREYFSTFGNIVSVSV 639 K L + L + I+E+DL+E +GN++ ++ Sbjct: 119 KDLIIQNLPKGIQEKDLKELLQLYGNVLVCNI 150 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 298 YRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKG 399 + TT+ L+ F+ +G + DV ++ D +T +KG Sbjct: 1075 FLTTELELETFFSNFGPVADVRIVCDRRTGLNKG 1108 >SB_7229| Best HMM Match : Neurokinin_B (HMM E-Value=7.9) Length = 155 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 120 SVSFLSLITSTFQVADASSVHASCRFLQPGGSTS 19 + +F+ +I S V+ + FLQPGGSTS Sbjct: 9 ATTFMIMIVVVAMSTATSLVNVTIEFLQPGGSTS 42 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/18 (66%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -2 Query: 68 AAFTPR-ADSCSPGDPLV 18 A+ PR ++SCSPGDPLV Sbjct: 20 ASLVPRPSNSCSPGDPLV 37 >SB_44083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 469 DGRIVEPKRAVPREEIKRPEASATV 543 D R VEP ++P E+KR A +V Sbjct: 99 DNRAVEPPESIPNSEVKRSIADGSV 123 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 9 PASNSCSPGDPLV 21 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 20 PTSNSCSPGDPLV 32 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = -2 Query: 65 AFTPRADSCSPGDPLV 18 +++ R++SCSPGDPLV Sbjct: 16 SYSFRSNSCSPGDPLV 31 >SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 69 SSVHASCRFLQPGGSTS 19 S H S FLQPGGSTS Sbjct: 28 SKKHKSIEFLQPGGSTS 44 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 74 MQAAFTPRADSCSPGDPLV 18 + A R++SCSPGDPLV Sbjct: 9 ISANIPKRSNSCSPGDPLV 27 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 68 AAFTPRADSCSPGDPLV 18 +A R++SCSPGDPLV Sbjct: 2 SARNERSNSCSPGDPLV 18 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 5 PTSNSCSPGDPLV 17 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 59 TPRADSCSPGDPLV 18 +P ++SCSPGDPLV Sbjct: 23 SPGSNSCSPGDPLV 36 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 86 SKLPMQAAFTPRADSCSPGDPLV 18 SK ++A + ++SCSPGDPLV Sbjct: 2 SKPTVEAFYFILSNSCSPGDPLV 24 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 86 SKLPMQAAFTPRADSCSPGDPLV 18 S+L +Q ++SCSPGDPLV Sbjct: 5 SRLLLQTYQRVESNSCSPGDPLV 27 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 182 PPSNSCSPGDPLV 194 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 16 PPSNSCSPGDPLV 28 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 381 RSNSCSPGDPLV 392 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 13 RSNSCSPGDPLV 24 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 63 PLSNSCSPGDPLV 75 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 24 PGSNSCSPGDPLV 36 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 39 RSNSCSPGDPLV 50 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 66 RSNSCSPGDPLV 77 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 16 PLSNSCSPGDPLV 28 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 63 RSNSCSPGDPLV 74 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 19 PPSNSCSPGDPLV 31 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_8443| Best HMM Match : Calx-beta (HMM E-Value=0) Length = 694 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/80 (23%), Positives = 39/80 (48%) Frame = +1 Query: 286 GGLDYRTTDSSLKEFYEQWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK 465 GG DY L+ ++ +I+D+ ++ D ++ + F I + ++V E + P Sbjct: 475 GGQDYEDAVGELEFLDDETHKIIDIAIIDDEDYEKKETFSVI-LGEPYVVKE-DAHFPTD 532 Query: 466 IDGRIVEPKRAVPREEIKRP 525 D + E K+ + EE+ +P Sbjct: 533 HDEEMDEEKKRI--EELGKP 550 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 558 RSNSCSPGDPLV 569 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 110 RSNSCSPGDPLV 121 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 59 TPRADSCSPGDPLV 18 T +++SCSPGDPLV Sbjct: 33 TAQSNSCSPGDPLV 46 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 6 RSNSCSPGDPLV 17 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +1 Query: 19 TSGSPGLQESARGVNAACIG 78 TSGSPGLQE V+A IG Sbjct: 14 TSGSPGLQEFDLNVDALAIG 33 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 39 PPSNSCSPGDPLV 51 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 92 RSNSCSPGDPLV 103 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 64 RSNSCSPGDPLV 75 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 107 FR*SPLLSKLPMQAAFTPRADSCSPGDPLV 18 FR L + + F ++SCSPGDPLV Sbjct: 7 FRCGHLTTNAATRVRFPLISNSCSPGDPLV 36 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 44 RSNSCSPGDPLV 55 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 11 RSNSCSPGDPLV 22 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 138 PGSNSCSPGDPLV 150 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 17 RSNSCSPGDPLV 28 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 45 RSNSCSPGDPLV 56 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 322 RSNSCSPGDPLV 333 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 60 RSNSCSPGDPLV 71 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -2 Query: 86 SKLPMQAAFTPR-ADSCSPGDPLV 18 SKLP T ++SCSPGDPLV Sbjct: 2 SKLPFVFRVTLEVSNSCSPGDPLV 25 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 69 SSVHASCRFLQPGGSTS 19 S + +S FLQPGGSTS Sbjct: 6 SKIRSSIEFLQPGGSTS 22 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 71 PPSNSCSPGDPLV 83 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 55 RSNSCSPGDPLV 66 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 96 PPSNSCSPGDPLV 108 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 214 RSNSCSPGDPLV 225 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 56 PRADSCSPGDPLV 18 P ++SCSPGDPLV Sbjct: 11 PGSNSCSPGDPLV 23 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 19 RSNSCSPGDPLV 30 >SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 96 TSTFQVADASSVHASCRFLQPGGSTS 19 T T A+ ++ FLQPGGSTS Sbjct: 5 TDTLISANIGKINEGIEFLQPGGSTS 30 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 1 RSNSCSPGDPLV 12 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 83 KLPMQAAFTPRADSCSPGDPLV 18 K+ M + ++SCSPGDPLV Sbjct: 10 KIKMSRKVSITSNSCSPGDPLV 31 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 35 RSNSCSPGDPLV 46 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 53 RADSCSPGDPLV 18 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,986,082 Number of Sequences: 59808 Number of extensions: 341973 Number of successful extensions: 2629 Number of sequences better than 10.0: 199 Number of HSP's better than 10.0 without gapping: 2482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2601 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -