BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0159 (316 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) 71 2e-13 SB_11031| Best HMM Match : VPS9 (HMM E-Value=8.3e-21) 33 0.064 SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) 30 0.45 SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.45 SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) 30 0.45 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 30 0.45 SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.45 SB_25209| Best HMM Match : Astacin (HMM E-Value=7.69999e-41) 28 1.8 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 28 1.8 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_10698| Best HMM Match : bZIP_1 (HMM E-Value=0.01) 27 2.4 SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) 27 2.4 SB_53645| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_19898| Best HMM Match : Merozoite_SPAM (HMM E-Value=3.7) 27 3.2 SB_18819| Best HMM Match : DUF822 (HMM E-Value=0.3) 27 3.2 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_10018| Best HMM Match : Sas10_Utp3 (HMM E-Value=7.6e-35) 27 3.2 SB_6454| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_29621| Best HMM Match : Halo_GVPC (HMM E-Value=5.3) 27 4.2 SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_41532| Best HMM Match : Extensin_2 (HMM E-Value=1.4) 27 4.2 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) 27 4.2 SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_21211| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) 26 5.6 SB_39562| Best HMM Match : DMAP1 (HMM E-Value=1.8) 26 5.6 SB_31180| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_50248| Best HMM Match : PPC (HMM E-Value=7.2) 26 7.4 SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.4 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.4 SB_37776| Best HMM Match : fn3 (HMM E-Value=1.4e-22) 26 7.4 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 25 9.8 SB_42524| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) 25 9.8 SB_30608| Best HMM Match : RFX1_trans_act (HMM E-Value=3.1) 25 9.8 SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06) 25 9.8 SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_59385| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_40770| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_34021| Best HMM Match : Zip (HMM E-Value=0) 25 9.8 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 25 9.8 SB_18643| Best HMM Match : Ion_trans (HMM E-Value=0) 25 9.8 SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) 25 9.8 SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 >SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) Length = 750 Score = 70.9 bits (166), Expect = 2e-13 Identities = 38/92 (41%), Positives = 56/92 (60%), Gaps = 2/92 (2%) Frame = +1 Query: 43 KSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNP 222 +++++ F S L+ V+T EK LP+ + +A EK + + F G+E F ++LKH ET EKNP Sbjct: 451 RAEVKSFEKSKLQHVETKEKNTLPTKDTIADEK-RTAPFSGVEVFQKNKLKHVETLEKNP 509 Query: 223 LPDKDAIEAE--KEKNKFLNGIENFDPTKLKH 312 LPD I AE E + + FD +KLKH Sbjct: 510 LPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKH 541 Score = 69.3 bits (162), Expect = 6e-13 Identities = 39/94 (41%), Positives = 57/94 (60%), Gaps = 2/94 (2%) Frame = +1 Query: 37 DLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFD--GIEKFDSSQLKHTETQ 210 D +++++ F+ S L+ V+T EK LPSA + E + L D + FD+S+LKH E Q Sbjct: 638 DSRAEVKSFDHSKLKHVETVEKNPLPSAAVLKEEMRPEVLPDVSAVASFDASKLKHVEVQ 697 Query: 211 EKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKH 312 EKNPLP KD I E + + ++ FD +KLKH Sbjct: 698 EKNPLPTKDDITTESTETR--AEVKTFDHSKLKH 729 Score = 66.9 bits (156), Expect = 3e-12 Identities = 37/92 (40%), Positives = 55/92 (59%), Gaps = 2/92 (2%) Frame = +1 Query: 43 KSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNP 222 +S++ F+TS L+ V+T EK+V+P+ + + E ++ FD S+LKH TQEKNP Sbjct: 528 RSEVAKFDTSKLKHVETKEKVVMPTKDVIEAEAIDSRA--EVKSFDHSKLKHVVTQEKNP 585 Query: 223 LPDKDAIEAEK-EKNK-FLNGIENFDPTKLKH 312 LP + E KNK + + +FD TKLKH Sbjct: 586 LPTPQTLHEELIPKNKPDRSEVASFDHTKLKH 617 Score = 66.5 bits (155), Expect = 4e-12 Identities = 41/96 (42%), Positives = 59/96 (61%), Gaps = 2/96 (2%) Frame = +1 Query: 31 RTDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIE--KFDSSQLKHTE 204 RT S +E F + L+ V+T EK LP A+++ E + L D E KFD+S+LKH E Sbjct: 484 RTAPFSGVEVFQKNKLKHVETLEKNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVE 543 Query: 205 TQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKH 312 T+EK +P KD IEAE ++ +++FD +KLKH Sbjct: 544 TKEKVVMPTKDVIEAEAIDSR--AEVKSFDHSKLKH 577 Score = 61.7 bits (143), Expect = 1e-10 Identities = 30/70 (42%), Positives = 43/70 (61%) Frame = +1 Query: 46 SQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPL 225 S + F+ S L+ V+ EK LP+ +D+ TE T+ ++ FD S+LKH +T+EKNPL Sbjct: 681 SAVASFDASKLKHVEVQEKNPLPTKDDITTESTETRA--EVKTFDHSKLKHVQTEEKNPL 738 Query: 226 PDKDAIEAEK 255 PD I EK Sbjct: 739 PDAKTIAQEK 748 Score = 54.0 bits (124), Expect = 2e-08 Identities = 32/94 (34%), Positives = 56/94 (59%), Gaps = 2/94 (2%) Frame = +1 Query: 37 DLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIE--KFDSSQLKHTETQ 210 D +++++ F+ S L+ V T EK LP+ + + E K+ D E FD ++LKH TQ Sbjct: 562 DSRAEVKSFDHSKLKHVVTQEKNPLPTPQTLHEELIPKNKPDRSEVASFDHTKLKHVTTQ 621 Query: 211 EKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKH 312 EK+ +P ++ I+ E ++ +++FD +KLKH Sbjct: 622 EKSIMPSQEDIKEEAVDSR--AEVKSFDHSKLKH 653 Score = 48.0 bits (109), Expect = 2e-06 Identities = 25/77 (32%), Positives = 46/77 (59%), Gaps = 2/77 (2%) Frame = +1 Query: 88 DTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNK 267 DT ++I P +E + K + KFD++ LKH +T+EKN LP + I+ E + ++ Sbjct: 389 DTPQQI-WPGSEVAYVDGGSKPDVSEVAKFDAANLKHVQTKEKNTLPSDETIKQELQPDE 447 Query: 268 FLN--GIENFDPTKLKH 312 F + +++F+ +KL+H Sbjct: 448 FPDRAEVKSFEKSKLQH 464 >SB_11031| Best HMM Match : VPS9 (HMM E-Value=8.3e-21) Length = 900 Score = 32.7 bits (71), Expect = 0.064 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +1 Query: 82 DVDTNEKIVLPSAEDVATEKTQKSLFDG-IEKFDSSQLKHTETQEKNPLPDKDAIEAEKE 258 DV + P+ A EKT K + DG +EK+ + +T + L D D E+E Sbjct: 341 DVIGKPPAIPPAQVQAAEEKTPKDIIDGLLEKYKEIGSQMADTSADDGLDDDD---VEEE 397 Query: 259 KNKFLNGIENFDPTKLK 309 + L+ + F TK K Sbjct: 398 DDDVLDEADRFRDTKRK 414 >SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) Length = 385 Score = 29.9 bits (64), Expect = 0.45 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +1 Query: 109 LPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLP 228 L S D EKT D +E+F S +H T +KNPLP Sbjct: 194 LSSRSDHVQEKT-----DRLEQFSSQTGRHINTTKKNPLP 228 >SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 29.9 bits (64), Expect = 0.45 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -2 Query: 144 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFEL 49 GLL+GD+F R K N+ I VD T G + FEL Sbjct: 51 GLLAGDIFRRPKANILISVDGV-TKG-DKFEL 80 >SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) Length = 1558 Score = 29.9 bits (64), Expect = 0.45 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 9/91 (9%) Frame = +1 Query: 22 AAGRTDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDV------ATEKTQKSLFDGIEKFDS 183 A R +L+ + ++D+ T E+++ AED A E ++++F+ EK +S Sbjct: 1119 AHARLELREKQLQELAGTMKDLTTEEELIASYAEDAERAAEAAKEYRERTMFEIAEKINS 1178 Query: 184 ---SQLKHTETQEKNPLPDKDAIEAEKEKNK 267 + + TE Q+K + +EAE E+ + Sbjct: 1179 IKEQRRQQTEAQKKKMDEEIRRLEAELEEER 1209 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 29.9 bits (64), Expect = 0.45 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -2 Query: 144 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFEL 49 GLL+GD+F R K N+ I VD T G + FEL Sbjct: 74 GLLAGDIFRRPKANILISVDGV-TKG-DKFEL 103 >SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1268 Score = 29.9 bits (64), Expect = 0.45 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 3/105 (2%) Frame = +1 Query: 1 SKLVDPRAAGRTDLKSQLEGFNTSCLRDVDTNEKIV---LPSAEDVATEKTQKSLFDGIE 171 + +VDPR A K+ LE F S +RD + E I+ + SA TEK Q + + Sbjct: 805 ASVVDPRVASAA-AKAALEEF--SKMRD-EIPEAIIDSHVKSATSAKTEKDQDEEDNSEQ 860 Query: 172 KFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKL 306 + E ++ P+ + EKE L EN P ++ Sbjct: 861 NKSVDEAMQVEEEKTAEQPEAAPSKEEKEPETALGASENESPLEV 905 >SB_25209| Best HMM Match : Astacin (HMM E-Value=7.69999e-41) Length = 533 Score = 27.9 bits (59), Expect = 1.8 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Frame = -1 Query: 184 SNQTSRYRRIKTSGSSQ-WR 128 +N+TS+YRRI+ GS Q WR Sbjct: 62 TNRTSKYRRIRRRGSRQTWR 81 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 118 AEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEK 255 ++D EKT+ S+ + + DSS T+EK +KD E+ Sbjct: 1546 SDDGTDEKTEDSMQEDAKDLDSSNTASDTTKEKGKNKEKDKTVLER 1591 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 238 HLCPEAGSSPESRCASAGSNQTSRYRR 158 HL S P SRCA + S+ + RYRR Sbjct: 449 HLLVCNASDPNSRCAQSCSSFSRRYRR 475 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 136 EKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEK 261 E+ Q+ E+ + + KH E +EK +K+ +E EK+K Sbjct: 336 ERIQQEKEKQKERREKEKQKHQEKKEKERQREKEKLEKEKQK 377 >SB_10698| Best HMM Match : bZIP_1 (HMM E-Value=0.01) Length = 590 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 180 FEPAEAHRDSGEEPASGQRCYRSGEG 257 FEP E H DSG+E Y EG Sbjct: 266 FEPMEIHDDSGDEDVDSDDDYDDREG 291 >SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) Length = 1575 Score = 27.5 bits (58), Expect = 2.4 Identities = 14/74 (18%), Positives = 37/74 (50%) Frame = +1 Query: 13 DPRAAGRTDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQL 192 DP+ +G T+ +L+G T+ + +D P+ + ++ ++ + + + D + Sbjct: 1016 DPKKSGNTERVQELQGVVTTDRQTIDD------PNTSESRRQEARERNEERLSEIDELER 1069 Query: 193 KHTETQEKNPLPDK 234 K+ E + + PL ++ Sbjct: 1070 KNRELENQKPLRER 1083 >SB_53645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.1 bits (57), Expect = 3.2 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +1 Query: 85 VDTNEKIVLPSAEDVATEKTQKSLFDGIEKF-DSSQLKHTET-QEKNP 222 VD +E +++ S+ D + EK S +EK+ S Q K T++ QEK P Sbjct: 53 VDDHEVVIVVSSHDSSEEKRHLSTRYNLEKWPGSDQEKWTDSFQEKIP 100 >SB_19898| Best HMM Match : Merozoite_SPAM (HMM E-Value=3.7) Length = 446 Score = 27.1 bits (57), Expect = 3.2 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +1 Query: 148 KSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHT 315 KS+F + + + TET+E NP D +AE+ + G + T+ K T Sbjct: 276 KSVFKRNRPTEPASVPSTETKEANPNVTADTKQAEQNEGSMSEGTTSKTITENKTT 331 >SB_18819| Best HMM Match : DUF822 (HMM E-Value=0.3) Length = 866 Score = 27.1 bits (57), Expect = 3.2 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 Query: 160 DGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNK 267 D +E FD++ L HT+ N +++ +E +K++ Sbjct: 73 DNLEGFDNADLDHTDQSGINVKSEQEFVEVHLQKSR 108 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 27.1 bits (57), Expect = 3.2 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 202 RCASAGS---NQTSRYRRIKTSGSSQWRRLQQTEAQSFHWCRRHGD 74 RC G ++TS Y ++ SGSS RRL+ S+ R GD Sbjct: 29 RCRVIGEFELSKTSSYGDVELSGSSSRRRLRVMAMSSYRGVRVIGD 74 >SB_10018| Best HMM Match : Sas10_Utp3 (HMM E-Value=7.6e-35) Length = 430 Score = 27.1 bits (57), Expect = 3.2 Identities = 23/84 (27%), Positives = 45/84 (53%), Gaps = 5/84 (5%) Frame = +1 Query: 31 RTDLKSQLEGFNTSCLRDVDT----NEKIVLPSAEDVATEKTQ-KSLFDGIEKFDSSQLK 195 RT +K +LE ++ D++T ++ LP+A V T+K+ K + + S + K Sbjct: 232 RTLIK-ELEPTDSRLEEDIETLLAMHKNGELPNASMVQTKKSNLKVKLNMRHQAKSKKRK 290 Query: 196 HTETQEKNPLPDKDAIEAEKEKNK 267 HT+ ++ +PL + ++ +K K K Sbjct: 291 HTDKEDIDPLAYYEEVKMKKMKAK 314 >SB_6454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 3.2 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 106 VLPSAEDVATEKTQKSLFDGIEKFDSSQ 189 ++ A ++ATE+T K + G+E+ D Q Sbjct: 35 IVAGAAEIATEQTNKIIDKGLERVDEQQ 62 >SB_29621| Best HMM Match : Halo_GVPC (HMM E-Value=5.3) Length = 471 Score = 26.6 bits (56), Expect = 4.2 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 79 RDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTE 204 RD TN++I+L ED+ +K + D I D+ L+ E Sbjct: 413 RDEATNDQIILDGEEDLLDIDQEKCVEDQIPLDDAKYLQDVE 454 >SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1319 Score = 26.6 bits (56), Expect = 4.2 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +1 Query: 79 RDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKE 258 R D +E + P ED T+ + G+ D+SQLK + K +D E + Sbjct: 552 RGDDESEYTMFPEFEDEITDVNET----GVPADDTSQLKVQQPGHKRAFDAEDKKEPSAK 607 Query: 259 KNK 267 KN+ Sbjct: 608 KNQ 610 >SB_41532| Best HMM Match : Extensin_2 (HMM E-Value=1.4) Length = 1633 Score = 26.6 bits (56), Expect = 4.2 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +2 Query: 53 SKASTPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYSTVSRSLI 181 S A TP +VT TP+K + T R+ SL++ +S+ L+ Sbjct: 840 SPAKTPTKTVTDTPVKESPVKFSPTGK-RKKFSLHALLSQPLV 881 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 26.6 bits (56), Expect = 4.2 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 31 RTDLKSQLEGFNTSCLRDVDTNEKI-VLPSAEDVATEKTQKSLFDGIEKFDSSQLK 195 R DLK E F +C+ + D EK+ V + K Q+ D ++ +Q K Sbjct: 3204 RGDLKRTKESFREACIENSDLREKLSVTEEKLERVDAKLQELENDNVDALAEAQAK 3259 >SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) Length = 1452 Score = 26.6 bits (56), Expect = 4.2 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 175 FDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLK 309 +D Q K E PD+D +E E+E NG+E+ D K Sbjct: 839 YDVKQRKRLEQHASYEAPDEDEMEIERE---LQNGLESGDEDDTK 880 >SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 26.2 bits (55), Expect = 5.6 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +1 Query: 142 TQKSLFDGIEKFDSSQLKHTET---QEKNPLPDKDAIEAEKEKNKFLNGIENF 291 T L+ E+FD + H E +EKN + A E+ KNK + E F Sbjct: 480 TLACLYVDTEQFDKADTMHREVLHIKEKNNTITRGAAYREQVKNKLVKLAEEF 532 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 26.2 bits (55), Expect = 5.6 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = +1 Query: 13 DPRAAGRTDLKSQLEGF---NTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDS 183 D A D S++E N + +++ K+ L ++ A QKS IEK Sbjct: 2022 DALLAAEADYHSKMEEMLKKNEEDMENLNKEHKLKLDELQE-AHRLDQKSEVAAIEKKLK 2080 Query: 184 SQLKHTETQEKNPLPDKDAI 243 +Q+K + + K L K+A+ Sbjct: 2081 TQMKKNQNEMKKLLNHKEAL 2100 >SB_21211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 26.2 bits (55), Expect = 5.6 Identities = 16/67 (23%), Positives = 28/67 (41%) Frame = +1 Query: 58 GFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKD 237 G N +CL DV++ + + S ED E F +E+ S + ++ D Sbjct: 246 GINDACLVDVNSEDFNLTLSDEDCDIEGASFGAFSSMEEHSISVSSKITSSTEDETEDSG 305 Query: 238 AIEAEKE 258 E E++ Sbjct: 306 QGECERD 312 >SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) Length = 769 Score = 26.2 bits (55), Expect = 5.6 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 217 SSPESRCASAGSNQTSRYRRIK-TSGSSQWRRLQQTEAQS 101 S +S C++ GS TSR K T+GS+ R +Q+ +S Sbjct: 667 SGKDSTCSTRGSRDTSRDTSCKDTTGSAGTRPTRQSPRKS 706 >SB_39562| Best HMM Match : DMAP1 (HMM E-Value=1.8) Length = 351 Score = 26.2 bits (55), Expect = 5.6 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 88 DTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKN 219 DTN S +++ + + S G + DS+ L+ TETQ K+ Sbjct: 128 DTNSGSCKNSGDEMQNSRQRSSSNKGSLELDSNGLESTETQMKH 171 >SB_31180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 26.2 bits (55), Expect = 5.6 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Frame = +1 Query: 166 IEKFDSSQLKHTETQ--------EKNPLPDKDAIEAEKEKNKFLNGIE 285 I+K D+ L T+ + EK P+ D+D ++ E E + G+E Sbjct: 294 IDKLDAQALSMTQAEFNKKMFGDEKGPVSDQDRVDGESEPDVTCKGLE 341 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 26.2 bits (55), Expect = 5.6 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 217 SSPESRCASAGSNQTSRYRRIK-TSGSSQWRRLQQTEAQS 101 S +S C++ GS TSR K T+GS+ R +Q+ +S Sbjct: 1334 SGKDSTCSTRGSRDTSRDTSCKDTTGSAGTRPTRQSPRKS 1373 >SB_50248| Best HMM Match : PPC (HMM E-Value=7.2) Length = 427 Score = 25.8 bits (54), Expect = 7.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 119 LKTSPLRRPRSLYSTVSRSLI 181 +KTSP RRP S+ S SR + Sbjct: 171 IKTSPQRRPSSMPSPASRQAV 191 >SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 25.8 bits (54), Expect = 7.4 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +1 Query: 4 KLVDPRAAGRTDLKSQLEGFNTSCLRDVDTNEKIVLPSAED 126 K VDP +Q EGFN + + D EK LP ED Sbjct: 73 KGVDPEKLKFARGGTQWEGFNAPVILEGDVVEKGRLPGKED 113 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 25.8 bits (54), Expect = 7.4 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Frame = +1 Query: 115 SAEDVATEKTQKSLFDGIEKFDSSQL-KHTETQEKNPLPDKDAIEAEKEKNKFLNGIENF 291 S E+ + E++++ +G + S+++ K +ET+ K P DKD E + ++ + E+ Sbjct: 690 SEEEESEEESEEDEEEGAKPSASAKIAKTSETENKVPKVDKDDEEDDDDEEEESEEDESN 749 Query: 292 DPTKLKHT 315 P+ + T Sbjct: 750 KPSSRQVT 757 >SB_37776| Best HMM Match : fn3 (HMM E-Value=1.4e-22) Length = 1296 Score = 25.8 bits (54), Expect = 7.4 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 164 PSNKDFWVFSVATSSADGSTIFSLVSTSRRQ 72 PSN VFSV SS++ ++I S SRR+ Sbjct: 988 PSNASSGVFSVQVSSSETNSIESSPHQSRRR 1018 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 25.4 bits (53), Expect = 9.8 Identities = 16/66 (24%), Positives = 29/66 (43%) Frame = +1 Query: 70 SCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEA 249 S LR +D+N + + S D E +K L + + K + + LP++ A + Sbjct: 1428 SPLRALDSNAECAVSSDSDSELEDEKKPLASFCSQVKMHKTKEQQCNVEKTLPEESAQKR 1487 Query: 250 EKEKNK 267 KN+ Sbjct: 1488 TFVKNR 1493 >SB_42524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 25.4 bits (53), Expect = 9.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -3 Query: 146 WVFSVATSSADGSTIFSLVSTSRRQLVLKPSS*LFRSVRP 27 W+F V+ G I L TS + L + FR VRP Sbjct: 13 WMFGVSVCRLQGFLILLLAWTSLHIMALTAVNRYFRVVRP 52 >SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) Length = 454 Score = 25.4 bits (53), Expect = 9.8 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +1 Query: 178 DSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLK 309 +S +K TE KN D + EK++ KF + + KLK Sbjct: 177 ESQPVKETERNRKNSSSGDDDSDDEKQEEKFDQKMRDKVRNKLK 220 >SB_30608| Best HMM Match : RFX1_trans_act (HMM E-Value=3.1) Length = 476 Score = 25.4 bits (53), Expect = 9.8 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +1 Query: 64 NTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQE-KNPLPDKDA 240 +T +RD +T I LP+++ VA K Q + G+ +S + T + + DK A Sbjct: 270 DTVSIRDCETGVVIELPASQTVAPHKFQGKVQFGVTFPGTSSKSWSRTMDFPHKQQDKPA 329 Query: 241 IEAEKE 258 +++ Sbjct: 330 SRGQQD 335 >SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1276 Score = 25.4 bits (53), Expect = 9.8 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +1 Query: 55 EGFNTSCLRDVDTNEKIVLPSAEDVATEKT-QKSLFDGIEKFDSSQLKHTETQEKNPLPD 231 + FN + L D D +K +P +DV +K + L G + Q + + Q+ P Sbjct: 254 KSFNDASLYDADIVKKTSVPRPDDVTAKKVISRCLAMGKKSVVPVQAQDPQFQQAFMQPS 313 Query: 232 KDAIE 246 D+++ Sbjct: 314 MDSMQ 318 >SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06) Length = 1223 Score = 25.4 bits (53), Expect = 9.8 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = +1 Query: 97 EKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFL 273 ++++L + TE+ QK + I++ Q + E QE+ +D + +KE+ + L Sbjct: 224 QQLLLEEKQKTVTEEQQKLIQAQIDEQRERQKRLQEEQERLQEKQEDFLRKQKEQQEQL 282 >SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1668 Score = 25.4 bits (53), Expect = 9.8 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 6/91 (6%) Frame = +1 Query: 40 LKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFDSSQLKHTETQEKN 219 L SQLE L + + + PS+ A+ + KS+ K+D QLK Q K Sbjct: 112 LTSQLENMENHNL----SPKHLKQPSSTSSASSASGKSITSITSKYDPCQLKREIIQAKT 167 Query: 220 PLP------DKDAIEAEKEKNKFLNGIENFD 294 + +K ++E + +K F +EN D Sbjct: 168 RVERLRSEMEKVSVEVQAKKEGF-RQLENVD 197 >SB_59385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1038 Score = 25.4 bits (53), Expect = 9.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 134 VATSSADGSTIFSLVSTSRRQLVL 63 +A S +DG +F + +TS QLVL Sbjct: 991 LAFSRSDGDAVFLMKNTSNHQLVL 1014 >SB_40770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 25.4 bits (53), Expect = 9.8 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 2/86 (2%) Frame = +1 Query: 7 LVDPRAAGRTDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEKTQKSLFDGIEKFD-- 180 +V+ +G + L++ EG N S + V + + L AED+ TQ F F+ Sbjct: 227 IVETLKSGSSALRAIQEGMNASDVDKVLMDVEGTLEDAEDIQQSLTQVISFKHAAIFNHF 286 Query: 181 SSQLKHTETQEKNPLPDKDAIEAEKE 258 + +L + ++ D + +E E E Sbjct: 287 AERLGNKAISDQTGGDDMEELERELE 312 >SB_34021| Best HMM Match : Zip (HMM E-Value=0) Length = 808 Score = 25.4 bits (53), Expect = 9.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 169 EKFDSSQLKHTETQEKNPLPDKDAIEA 249 E FDS LKH ++ N +P+ + + Sbjct: 382 EDFDSYSLKHERVKQSNTVPNPSKVRS 408 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 25.4 bits (53), Expect = 9.8 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 159 RRYREV*FEPAEAHRDSGEEPASGQRCYRSGEGKEQIPERHRELRS 296 RR +E+ AE H+ EPA + + SGE E+ H E++S Sbjct: 35 RREQEIIELKAELHKRDDLEPAGQRHRHDSGESFEE----HEEIKS 76 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 25.4 bits (53), Expect = 9.8 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 136 EKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNK 267 E QK + +EK + K E EK +KD +E +++K + Sbjct: 345 EAKQKKEQERLEKQAEKEKKEKERLEKKQREEKDRLEKKEKKEE 388 >SB_18643| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1885 Score = 25.4 bits (53), Expect = 9.8 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = +1 Query: 82 DVDTNEKIVLPSAEDVAT--EKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEK 255 ++D ++ IV +++A + + L D E+ S+L+ T E+ ++ +EAE Sbjct: 1797 ELDEDDTIVRVVEQEIAEAFDLSTDQLNDAAERL-LSELEETLKNEEEVEKEEARLEAEA 1855 Query: 256 EKNKFLNGIENF 291 + +K G +NF Sbjct: 1856 QADKSEEGKDNF 1867 >SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) Length = 1293 Score = 25.4 bits (53), Expect = 9.8 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 159 RRYREV*FEPAEAHRDSGEEPASGQRCYRSGEGKEQIPERHRELRS 296 RR +E+ AE H+ EPA + + SGE E+ H E++S Sbjct: 11 RREQEIIELKAELHKRDDLEPAGQRHRHDSGESFEE----HEEIKS 52 >SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 25.4 bits (53), Expect = 9.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 103 SFHWCRRHGDSWC*SLRADSSGLCDLQPGDPLV 5 + H C GD S R D LQPGDPLV Sbjct: 12 NIHLCGSFGDHSYLSTRVDRIEF--LQPGDPLV 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.307 0.127 0.345 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,288,826 Number of Sequences: 59808 Number of extensions: 178255 Number of successful extensions: 612 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 400488992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -