BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0153 (431 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 25 0.48 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 25 0.48 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 1.1 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 2.6 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 3.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 4.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 4.5 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 4.5 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 5.9 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 24.6 bits (51), Expect = 0.48 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -3 Query: 198 FLYCRRSLGVAPDRNMTNKGGDESFGCHFRKFLETLGSNATKAYDL 61 F Y + LG P+R + +G E FL ++ + TK+Y++ Sbjct: 593 FTYSEKMLGF-PERLILPRGKPEGMRYKMFFFLSSMDESNTKSYEI 637 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 24.6 bits (51), Expect = 0.48 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -3 Query: 198 FLYCRRSLGVAPDRNMTNKGGDESFGCHFRKFLETLGSNATKAYDL 61 F Y + LG P+R + +G E FL ++ + TK+Y++ Sbjct: 593 FTYSEKMLGF-PERLILPRGKPEGMRYKMFFFLSSMDESNTKSYEI 637 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 290 SKLALVMNHKLNWDCRMYYDQL 355 SK L+ + LNW R +YD L Sbjct: 30 SKYQLITSTTLNWLPRTHYDHL 51 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.2 bits (45), Expect = 2.6 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 327 GIVACTTISCWTNNQ 371 G+V T+++CW N+ Sbjct: 318 GLVGDTSLACWNENR 332 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.8 bits (44), Expect = 3.4 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 327 GIVACTTISCWTNNQ 371 G+V+ T + CW N+ Sbjct: 317 GLVSDTALGCWNENR 331 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 105 TYENGIQNSRRPLYSS 152 TY NG+ +RP++S+ Sbjct: 300 TYSNGLPFPQRPIWSN 315 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 105 TYENGIQNSRRPLYSS 152 TY NG+ +RP++S+ Sbjct: 300 TYSNGLPFPQRPIWSN 315 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 4.5 Identities = 6/21 (28%), Positives = 14/21 (66%) Frame = +2 Query: 83 LLPKVSKNLRKWHPKLSSPPL 145 +LPK++ + +W+P + P+ Sbjct: 519 VLPKLTLEVEEWNPLTDTVPI 539 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 5.9 Identities = 5/16 (31%), Positives = 10/16 (62%) Frame = +3 Query: 324 IGIVACTTISCWTNNQ 371 +G+V + + CW +Q Sbjct: 317 VGLVGNSAVGCWNEHQ 332 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,665 Number of Sequences: 438 Number of extensions: 2000 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11244597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -