BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0152 (712 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97403-3|AAB52473.1| 142|Caenorhabditis elegans Hypothetical pr... 28 5.7 AF068713-4|AAC17795.2| 398|Caenorhabditis elegans Hypothetical ... 28 5.7 >U97403-3|AAB52473.1| 142|Caenorhabditis elegans Hypothetical protein T10E9.6 protein. Length = 142 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -1 Query: 319 IVNYF*PLNK*LTIIYFLIVL*VQFFHFMNNVKDYSPIYYMELLTLPQHQNLPP 158 I+ Y P ++ T I F+ FF+ + + +Y P+YY+ L + LPP Sbjct: 73 ILTYLGPSDRPETGIMFIYWTIFGFFYLFDRILEYIPLYYIIKLAVFIGLFLPP 126 >AF068713-4|AAC17795.2| 398|Caenorhabditis elegans Hypothetical protein T24A6.8 protein. Length = 398 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -1 Query: 706 YHCVIQRCV*LEKFYVNIALCFGLINCKKTANCF 605 YHC + C + F+ + L G I C + +C+ Sbjct: 44 YHCDVATCKGCKTFFRRMCLLRGEIKCSTSGDCY 77 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,918,487 Number of Sequences: 27780 Number of extensions: 259408 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -