BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0152 (712 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g35460.1 68418.m04217 expressed protein 29 4.0 At2g39780.1 68415.m04884 ribonuclease 2 (RNS2) identical to ribo... 27 9.3 >At5g35460.1 68418.m04217 expressed protein Length = 381 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 376 WFFLIKNYIHSHWSVCYFSIVN 311 W FL+ +++ W V YF IVN Sbjct: 224 WLFLVPLVVYTLWQVLYFLIVN 245 >At2g39780.1 68415.m04884 ribonuclease 2 (RNS2) identical to ribonuclease 2 precursor SP:P42814, GI:289210; contains a ribonuclease T2 family histidine active site signature (PDOC00459) Length = 259 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 215 LTDLLYGASNIASTSKSSAIF*IVFVLQNSF 123 +TD+LY A +AS S+ + IV +QN+F Sbjct: 160 VTDVLYQAGYVASNSEKYPLGGIVTAIQNAF 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,368,288 Number of Sequences: 28952 Number of extensions: 206510 Number of successful extensions: 382 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -