BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0149 (554 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0209 - 23282848-23284110 29 3.3 02_05_0640 - 30558523-30559027,30559123-30559252,30559388-305598... 27 7.6 >05_05_0209 - 23282848-23284110 Length = 420 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -3 Query: 438 LAAANIRQRALAVVLPTVPGIEAVTFVNFLSAFRCLSDVVSQEVGALNVAVFAWT 274 +A A RA+ L ++ I AV F+ + L + ++ ALNVA+ AWT Sbjct: 243 VAVAGHLNRAMLAALVSMATILAVEFLQWWFMLSLLPEAIAV---ALNVAIMAWT 294 >02_05_0640 - 30558523-30559027,30559123-30559252,30559388-30559868, 30560292-30560346,30560537-30560613,30561228-30561315, 30561490-30561593,30562050-30562231,30562347-30563109, 30563195-30563438,30564513-30564658,30565158-30565283, 30565404-30565517,30565595-30565762,30566283-30566528, 30566605-30566767,30566970-30567064,30567274-30567357, 30567769-30568055,30568359-30568572,30568923-30569140, 30569386-30569623,30570312-30571118,30571202-30571301, 30571694-30571737,30571824-30571973 Length = 1942 Score = 27.5 bits (58), Expect = 7.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 188 VSRLLSCSTRHTQFLMRFSSKPCFLSSCTRPHLV-NVLASEPTQRTTKAKIINF 30 V +L S T Q ++R + L+ R +V N L+S+P + T KII+F Sbjct: 476 VDKLASRVTNSDQQILRSNHVTWLLAQIIRIEIVMNTLSSDPRKVETTRKIISF 529 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,052,443 Number of Sequences: 37544 Number of extensions: 274419 Number of successful extensions: 697 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -