BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0142 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.11 |||amidohydrolase|Schizosaccharomyces pombe|chr 1|||... 27 2.7 SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||M... 27 2.7 SPBP23A10.02 |||conserved fungal protein|Schizosaccharomyces pom... 26 3.6 SPAC959.05c |||protein disulfide isomerase |Schizosaccharomyces ... 26 4.8 >SPAC26A3.11 |||amidohydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 322 Score = 26.6 bits (56), Expect = 2.7 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 423 QKNTLYYISSFHFFITN*LHILFSSSVLIVNDFRAFGISL 542 QK T + S +F T + + S+S L+ DFRAF I L Sbjct: 10 QKGTRSFFPSLNFCYTRNI-MSVSASSLVPKDFRAFRIGL 48 >SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||Manual Length = 535 Score = 26.6 bits (56), Expect = 2.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 152 YGLVLKICIWNSTKYFIILYLAITW 226 + L+LK+ +W + Y+ + L TW Sbjct: 25 FDLILKVLLWTAPWYYCLTTLFFTW 49 >SPBP23A10.02 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 132 Score = 26.2 bits (55), Expect = 3.6 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +2 Query: 164 LKICIWNSTKYFIILYLAITWDNNPSRCAHRNXXXXXXDNSNSQRNTN 307 L IC+W S +F++ LA NN + + ++ DNSN+Q +N Sbjct: 53 LAICLWLSLTWFLV-ELAHARVNNDLQMSSQS-ANKNDDNSNNQNPSN 98 >SPAC959.05c |||protein disulfide isomerase |Schizosaccharomyces pombe|chr 1|||Manual Length = 632 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 541 REIPKALKSLTIKTDEEKSMCS*LVIKK 458 R + LK + DEEK MC+ IKK Sbjct: 224 RNTDERLKMAQVNCDEEKEMCNHFHIKK 251 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,110,731 Number of Sequences: 5004 Number of extensions: 40235 Number of successful extensions: 54 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -