Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0141
         (626 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q96RI9 Cluster: Trace amine-associated receptor 9; n=83...    33   7.4  

>UniRef50_Q96RI9 Cluster: Trace amine-associated receptor 9; n=83;
           Theria|Rep: Trace amine-associated receptor 9 - Homo
           sapiens (Human)
          Length = 348

 Score = 32.7 bits (71), Expect = 7.4
 Identities = 11/30 (36%), Positives = 24/30 (80%)
 Frame = -1

Query: 338 NRNLLLVCYILYYVGNVPVVLNFTEIYLSA 249
           N+N +L+C++L+++ NV +V  +++I+L A
Sbjct: 195 NQNWVLLCFLLFFIPNVAMVFIYSKIFLVA 224


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 515,967,470
Number of Sequences: 1657284
Number of extensions: 8539944
Number of successful extensions: 16737
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 16284
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16735
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46051731393
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)