BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0141 (626 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183469-1|AAO24660.1| 348|Homo sapiens trace amine receptor 3 ... 33 1.1 AF380189-1|AAK71240.1| 348|Homo sapiens trace amine receptor 3 ... 33 1.1 >AY183469-1|AAO24660.1| 348|Homo sapiens trace amine receptor 3 protein. Length = 348 Score = 32.7 bits (71), Expect = 1.1 Identities = 11/30 (36%), Positives = 24/30 (80%) Frame = -1 Query: 338 NRNLLLVCYILYYVGNVPVVLNFTEIYLSA 249 N+N +L+C++L+++ NV +V +++I+L A Sbjct: 195 NQNWVLLCFLLFFIPNVAMVFIYSKIFLVA 224 >AF380189-1|AAK71240.1| 348|Homo sapiens trace amine receptor 3 protein. Length = 348 Score = 32.7 bits (71), Expect = 1.1 Identities = 11/30 (36%), Positives = 24/30 (80%) Frame = -1 Query: 338 NRNLLLVCYILYYVGNVPVVLNFTEIYLSA 249 N+N +L+C++L+++ NV +V +++I+L A Sbjct: 195 NQNWVLLCFLLFFIPNVAMVFIYSKIFLVA 224 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,834,567 Number of Sequences: 237096 Number of extensions: 1234627 Number of successful extensions: 2203 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2203 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6804036910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -