BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0138 (624 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81463-4|CAB03852.2| 3118|Caenorhabditis elegans Hypothetical pr... 30 1.5 Z81491-13|CAN86583.1| 181|Caenorhabditis elegans Hypothetical p... 29 3.6 >Z81463-4|CAB03852.2| 3118|Caenorhabditis elegans Hypothetical protein C06B8.7 protein. Length = 3118 Score = 29.9 bits (64), Expect = 1.5 Identities = 25/59 (42%), Positives = 30/59 (50%) Frame = -3 Query: 619 HNRECDIYVSDLGTISLPSIRQGIV*VRGKFYLFIYNLNNTACCLLDGIDTNITLLKNI 443 HNR +Y+S T S P +R G + K LF YN N+TA L ITLL NI Sbjct: 2442 HNRG-GLYIS--ATSSSPVVRLGALI---KNCLFAYNSNSTALALSGNNYQVITLLNNI 2494 >Z81491-13|CAN86583.1| 181|Caenorhabditis elegans Hypothetical protein D1086.18 protein. Length = 181 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 417 SSIETNEYYIFFNNVIFVSIPSSKQHAVLLR 509 +SIE N Y FF ++++IP KQ L+ Sbjct: 116 TSIEDNCVYSFFMTPVYINIPDKKQRCETLK 146 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,152,679 Number of Sequences: 27780 Number of extensions: 217881 Number of successful extensions: 364 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -