BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0136 (533 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.03c |||lathosterol oxidase |Schizosaccharomyces pombe|... 26 4.1 SPAC6B12.15 |cpc2|rkp1|RACK1 homologue Cpc2|Schizosaccharomyces ... 25 5.4 SPAC1687.16c |erg3||C-5 sterol desaturase Erg3 |Schizosaccharomy... 25 9.4 >SPBC27B12.03c |||lathosterol oxidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 25.8 bits (54), Expect = 4.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 394 LYNRVAFLQHRYIIPRPVSSH 332 LY + L H++I+P P SSH Sbjct: 178 LYAPLHKLHHKWIVPTPYSSH 198 >SPAC6B12.15 |cpc2|rkp1|RACK1 homologue Cpc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 314 Score = 25.4 bits (53), Expect = 5.4 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 502 YSLSINLSINALTICQGRLWTPCLHG-SIKIF 410 YSL +INAL R W G SI+IF Sbjct: 228 YSLEAKANINALVFSPNRYWLCAATGSSIRIF 259 >SPAC1687.16c |erg3||C-5 sterol desaturase Erg3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 24.6 bits (51), Expect = 9.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 412 FLCYIMLYNRVAFLQHRYIIPRPVSSH 332 FL + +Y R+ L H++II P +SH Sbjct: 139 FLHHRYVYPRLHKLHHKWIICTPYASH 165 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,997,306 Number of Sequences: 5004 Number of extensions: 38873 Number of successful extensions: 71 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -