BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0136 (533 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC044840-1|AAH44840.1| 597|Homo sapiens giant axonal neuropathy... 30 5.9 AF291673-1|AAG35311.1| 597|Homo sapiens gigaxonin protein. 30 5.9 >BC044840-1|AAH44840.1| 597|Homo sapiens giant axonal neuropathy (gigaxonin) protein. Length = 597 Score = 29.9 bits (64), Expect = 5.9 Identities = 20/61 (32%), Positives = 26/61 (42%) Frame = +1 Query: 211 DRHLAENGAHAPCQINILHKFIHHYFIEKLKYKIPN*TSLSEMTPVEELYIYVEEMLLDY 390 D HL +G P Q NIL Y KL Y P + +E + + V +LDY Sbjct: 31 DAHLVLDGEEIPVQKNIL-AAASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREILDY 89 Query: 391 I 393 I Sbjct: 90 I 90 >AF291673-1|AAG35311.1| 597|Homo sapiens gigaxonin protein. Length = 597 Score = 29.9 bits (64), Expect = 5.9 Identities = 20/61 (32%), Positives = 26/61 (42%) Frame = +1 Query: 211 DRHLAENGAHAPCQINILHKFIHHYFIEKLKYKIPN*TSLSEMTPVEELYIYVEEMLLDY 390 D HL +G P Q NIL Y KL Y P + +E + + V +LDY Sbjct: 31 DAHLVLDGEEIPVQKNIL-AAASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREILDY 89 Query: 391 I 393 I Sbjct: 90 I 90 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,515,778 Number of Sequences: 237096 Number of extensions: 1272313 Number of successful extensions: 1736 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1736 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5216942984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -