BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0135 (658 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55376-3|AAA98005.3| 525|Caenorhabditis elegans Nuclear hormone... 31 0.54 AF016430-2|AAB65371.1| 1106|Caenorhabditis elegans Gex interacti... 27 8.9 >U55376-3|AAA98005.3| 525|Caenorhabditis elegans Nuclear hormone receptor familyprotein 45 protein. Length = 525 Score = 31.5 bits (68), Expect = 0.54 Identities = 13/55 (23%), Positives = 32/55 (58%) Frame = +2 Query: 89 QPSKYRQQTHIYDPHIEIIS*NKVCFIFAISTDAIKGDAELHKTSNSSNGTVVEK 253 +P + QQ +P ++ N F+ +++DA + ++++H+ + S + TV+E+ Sbjct: 112 RPPSFEQQQQNQNPDPPLLMGNNGTFVQEVASDAYQPNSDMHQLNFSFHRTVIEE 166 >AF016430-2|AAB65371.1| 1106|Caenorhabditis elegans Gex interacting protein protein 6 protein. Length = 1106 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 51 TCSAVLTIFFFKTNHPNTDNKHIFTIRTLKSSVKTKFVLFSQ 176 TCS + T+ FFK P + K ++ S+ KT F + S+ Sbjct: 64 TCSVLATLSFFKQRQPASGGKTEDIFKSYCSNCKTFFGMSSK 105 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,621,506 Number of Sequences: 27780 Number of extensions: 293648 Number of successful extensions: 831 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -