BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0135 (658 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69200.1 68414.m07921 pfkB-type carbohydrate kinase family pr... 30 1.6 At5g66160.2 68418.m08334 protease-associated zinc finger (C3HC4-... 29 3.6 At5g66160.1 68418.m08335 protease-associated zinc finger (C3HC4-... 29 3.6 >At1g69200.1 68414.m07921 pfkB-type carbohydrate kinase family protein contains Pfam profile: PF00294 pfkB family carbohydrate kinase Length = 614 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +2 Query: 155 KVCFIFAISTDAIKGDAELHKTSNSSNGTVVEKKPISRHAKLLNSKVVIR 304 K F A + A L + N NG VV KKP + KVV++ Sbjct: 39 KQSFSMAAGRRKLSESAPLEEEGNDGNGAVVGKKPSKSVKRTTKKKVVVK 88 >At5g66160.2 68418.m08334 protease-associated zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF02225: protease-associated (PA) domain and Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger); similar to ReMembR-H2 protein JR702 [Arabidopsis thaliana] gi|6942149|gb|AAF32326; identical to cDNA ReMembR-H2 protein JR700 mRNA, complete cds GI:6942146 Length = 290 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 537 LIIVVQFLLIAFPVDRHW 484 L+++V FLLIAF RHW Sbjct: 177 LLLIVTFLLIAFFAPRHW 194 >At5g66160.1 68418.m08335 protease-associated zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF02225: protease-associated (PA) domain and Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger); similar to ReMembR-H2 protein JR702 [Arabidopsis thaliana] gi|6942149|gb|AAF32326; identical to cDNA ReMembR-H2 protein JR700 mRNA, complete cds GI:6942146 Length = 310 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 537 LIIVVQFLLIAFPVDRHW 484 L+++V FLLIAF RHW Sbjct: 177 LLLIVTFLLIAFFAPRHW 194 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,475,430 Number of Sequences: 28952 Number of extensions: 259370 Number of successful extensions: 680 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -