BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0134 (674 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9AHX3 Cluster: Putative uncharacterized protein; n=2; ... 36 1.2 UniRef50_A2Y237 Cluster: Putative uncharacterized protein; n=1; ... 34 2.7 UniRef50_Q8RBS3 Cluster: Transcriptional regulator; n=3; Thermoa... 33 6.3 UniRef50_Q8I3Q3 Cluster: Putative uncharacterized protein PFE104... 33 8.4 >UniRef50_Q9AHX3 Cluster: Putative uncharacterized protein; n=2; Candidatus Carsonella ruddii|Rep: Putative uncharacterized protein - Carsonella ruddii Length = 61 Score = 35.5 bits (78), Expect = 1.2 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -2 Query: 601 FLLLSHKSGHVFLLNFFIYYLKTCNFLKKSK 509 FL L + ++FL+NFF Y+ CNF+KK K Sbjct: 8 FLNLKKRYFYIFLINFF-YFFNKCNFIKKKK 37 >UniRef50_A2Y237 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 805 Score = 34.3 bits (75), Expect = 2.7 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = -2 Query: 565 LLNFFIYYLKTCNFLKKSKRSVLLFHL*TYLKIKQHQNFFTVILKQSCGQMV 410 L F I + C+F KK KRS+L + TY ++ + N FT +L Q MV Sbjct: 474 LATFSICIMLCCHFCKKPKRSLLGVRVFTYKELSKATNGFTELLGQGGFGMV 525 >UniRef50_Q8RBS3 Cluster: Transcriptional regulator; n=3; Thermoanaerobacter|Rep: Transcriptional regulator - Thermoanaerobacter tengcongensis Length = 220 Score = 33.1 bits (72), Expect = 6.3 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = -1 Query: 497 VISFVNVFKNKTTSKLLYCD----FKTKLWANGNVKDILLLI 384 +I+F N KNKT S Y D FK KL+ N N + IL LI Sbjct: 134 IIAFANQLKNKTRSLSDYLDLYNAFKGKLYTNLNYEQILALI 175 >UniRef50_Q8I3Q3 Cluster: Putative uncharacterized protein PFE1045c; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFE1045c - Plasmodium falciparum (isolate 3D7) Length = 2054 Score = 32.7 bits (71), Expect = 8.4 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +1 Query: 370 QNVTYISNNISFTLPFAHNFVLKSQ*RSFDVVLFLNTFTNEITIHFFCFFLKN 528 +N+ Y+ NN+ P +N L Q R FLN +T H F F L N Sbjct: 985 ENMKYVINNLKIKYPLQNNITLNDQNREEIAYYFLNYYTK----HIFRFDLPN 1033 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,894,605 Number of Sequences: 1657284 Number of extensions: 10540098 Number of successful extensions: 19950 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19948 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52066120554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -