BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0132 (504 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.54 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.54 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.94 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.94 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.94 SB_3242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.94 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 30 1.2 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 29 2.2 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 29 2.9 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_58381| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 29 2.9 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 29 2.9 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 28 3.8 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) 28 3.8 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 28 3.8 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 5.0 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 28 5.0 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 5.0 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 27 6.6 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 6.6 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 27 6.6 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 27 6.6 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 27 6.6 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_24355| Best HMM Match : SAM_2 (HMM E-Value=3e-07) 27 6.6 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 27 6.6 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 27 6.6 SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 27 8.8 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 27 8.8 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 33.1 bits (72), Expect = 0.13 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 68 VFLLPLPRADSCSPGDPLV 12 + L P PR++SCSPGDPLV Sbjct: 62 LILQPHPRSNSCSPGDPLV 80 >SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.7 bits (71), Expect = 0.18 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -1 Query: 63 PTPFASCRFLQPGGSTS 13 PTPF FLQPGGSTS Sbjct: 3 PTPFVGIEFLQPGGSTS 19 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -2 Query: 71 EVFLLPLPRADSCSPGDPLV 12 + F P+P ++SCSPGDPLV Sbjct: 2 QYFGRPVPASNSCSPGDPLV 21 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.5 bits (68), Expect = 0.41 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 11 KLVDPPGCRNRHEAKGVGIP 70 +LVDPPGCRN +++ VG P Sbjct: 77 ELVDPPGCRNSMDSRVVGKP 96 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.1 bits (67), Expect = 0.54 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 +PR++SCSPGDPLV Sbjct: 1 MPRSNSCSPGDPLV 14 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.1 bits (67), Expect = 0.54 Identities = 14/18 (77%), Positives = 16/18 (88%), Gaps = 2/18 (11%) Frame = -2 Query: 59 LPLP--RADSCSPGDPLV 12 LPLP R++SCSPGDPLV Sbjct: 9 LPLPCLRSNSCSPGDPLV 26 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 0.71 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -2 Query: 68 VFLLPLPRADSCSPGDPLV 12 V +L +P ++SCSPGDPLV Sbjct: 10 VMVLHVPPSNSCSPGDPLV 28 >SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 0.71 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 99 VLSEGGGCVGGIPTPFASCRFLQPGGSTS 13 ++S GC G P + FLQPGGSTS Sbjct: 8 LISANIGCNRGCPLGVSMIEFLQPGGSTS 36 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 0.94 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 PR++SCSPGDPLV Sbjct: 21 PRSNSCSPGDPLV 33 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 0.94 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 PR++SCSPGDPLV Sbjct: 16 PRSNSCSPGDPLV 28 >SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 0.94 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 75 VGGIPTPFASCRFLQPGGSTS 13 +G P F S FLQPGGSTS Sbjct: 13 IGSPPKIFVSIEFLQPGGSTS 33 >SB_3242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 30.3 bits (65), Expect = 0.94 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = -1 Query: 105 LAVLSEGGGCVGGIPTPFASCRFLQPGGSTS 13 L VL+ GG GG S FLQPGGSTS Sbjct: 5 LIVLTAGGVACGG--DVITSIEFLQPGGSTS 33 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = -2 Query: 101 QCYQKVEAV*EVFLLPLPRAD----SCSPGDPLV 12 +C + E + P+PR D SCSPGDPLV Sbjct: 359 ECLTGAQGGEEQSVFPVPRVDRRSNSCSPGDPLV 392 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 59 LPLPRADSCSPGDPLV 12 LP+ ++SCSPGDPLV Sbjct: 17 LPINESNSCSPGDPLV 32 >SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -2 Query: 62 LLPLPRADSCSPGDPLV 12 ++PL ++SCSPGDPLV Sbjct: 1 MVPLHSSNSCSPGDPLV 17 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 59 LPLPRADSCSPGDPLV 12 LPL ++SCSPGDPLV Sbjct: 25 LPLVPSNSCSPGDPLV 40 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 11 KLVDPPGCRNRHEAKGV 61 +LVDPPGCRN +A+ V Sbjct: 14 ELVDPPGCRNSIQARSV 30 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 11 KLVDPPGCRNRHEAKGV 61 +LVDPPGCRN + GV Sbjct: 31 ELVDPPGCRNSIDGNGV 47 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 71 EVFLLPLPRADSCSPGDPLV 12 + + L R++SCSPGDPLV Sbjct: 4 DTLYVKLERSNSCSPGDPLV 23 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 LP ++SCSPGDPLV Sbjct: 137 LPGSNSCSPGDPLV 150 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 L R++SCSPGDPLV Sbjct: 2 LARSNSCSPGDPLV 15 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 56 PLPRADSCSPGDPLV 12 PL ++SCSPGDPLV Sbjct: 889 PLVTSNSCSPGDPLV 903 >SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 63 PTPFASCRFLQPGGSTS 13 PTP FLQPGGSTS Sbjct: 28 PTPTQCIEFLQPGGSTS 44 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 2.9 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 59 LPLPRADSCSPGDPLV 12 + +P ++SCSPGDPLV Sbjct: 13 IDIPLSNSCSPGDPLV 28 >SB_58381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 78 CVGGIPTPFASCRFLQPGGSTS 13 C+ +PT FLQPGGSTS Sbjct: 68 CLDKLPTLLQFIEFLQPGGSTS 89 >SB_57323| Best HMM Match : ShTK (HMM E-Value=0) Length = 911 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 65 IPPTQPPPSDNTANNRKICSKIPK 136 +PPTQPP +D AN + S PK Sbjct: 794 VPPTQPPVTDAPANCKDTYSGCPK 817 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 65 IPPTQPPPSDNTANNRKICSKIPK 136 +PPTQPP +D A+ + I S P+ Sbjct: 719 VPPTQPPVTDAPAHCKDIYSDCPE 742 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 L R++SCSPGDPLV Sbjct: 62 LSRSNSCSPGDPLV 75 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 11 KLVDPPGCRNRHEAKG 58 +LVDPPGCRN + KG Sbjct: 14 ELVDPPGCRNSIKDKG 29 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 L R++SCSPGDPLV Sbjct: 27 LQRSNSCSPGDPLV 40 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 2.9 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P+++SCSPGDPLV Sbjct: 30 PQSNSCSPGDPLV 42 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 65 FLLPLPRADSCSPGDPLV 12 +L+ R++SCSPGDPLV Sbjct: 39 YLVDPARSNSCSPGDPLV 56 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.7 bits (61), Expect = 2.9 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -2 Query: 95 YQKVEAV*EVFLLPLPRADSCSPGDPLV 12 YQ+ V V +LP R++SCSPGDPLV Sbjct: 46 YQRCTPV--VGMLPR-RSNSCSPGDPLV 70 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -2 Query: 68 VFLLPLPRADSCSPGDPLV 12 VF + L ++SCSPGDPLV Sbjct: 7 VFRVTLEVSNSCSPGDPLV 25 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 L R++SCSPGDPLV Sbjct: 10 LTRSNSCSPGDPLV 23 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 28.3 bits (60), Expect = 3.8 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 +P ++SCSPGDPLV Sbjct: 181 IPPSNSCSPGDPLV 194 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 71 EVFLLPLPRADSCSPGDPLV 12 E L P ++SCSPGDPLV Sbjct: 56 ETILEVQPLSNSCSPGDPLV 75 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 3.8 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -2 Query: 62 LLPLPRADSCSPGDPLV 12 ++ P ++SCSPGDPLV Sbjct: 20 IVEFPGSNSCSPGDPLV 36 >SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) Length = 1338 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +2 Query: 20 DPPGCRNRHEAKGVGIPPTQPPPSDNTANNRKICSKIPKHQVCTMDRAQIINGALES 190 D P ++ E K V +P Q P S++ + +K K PK Q +++NG + S Sbjct: 661 DAPLTCSKKEDKEVIVPDPQEPTSNDNEHEKKEPEK-PKEQGGRKKSRRVLNGLIRS 716 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 59 LPLPRADSCSPGDPLV 12 LP ++SCSPGDPLV Sbjct: 3 LPSKSSNSCSPGDPLV 18 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/15 (80%), Positives = 13/15 (86%), Gaps = 1/15 (6%) Frame = +2 Query: 11 KLVDPPGCRNR-HEA 52 +LVDPPGCRN HEA Sbjct: 14 ELVDPPGCRNSIHEA 28 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 62 LLPLPRADSCSPGDPLV 12 L+P ++SCSPGDPLV Sbjct: 24 LIPKIASNSCSPGDPLV 40 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 3.8 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = -2 Query: 62 LLPLPRADSCSPGDPLV 12 ++ + R++SCSPGDPLV Sbjct: 20 IIAVRRSNSCSPGDPLV 36 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 62 LLPLPRADSCSPGDPLV 12 +LP P ++SCSPGDPLV Sbjct: 16 VLPAP-SNSCSPGDPLV 31 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 L R++SCSPGDPLV Sbjct: 53 LMRSNSCSPGDPLV 66 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 62 LLPLPRADSCSPGDPLV 12 L+P P ++SCSPGDPLV Sbjct: 22 LVPRP-SNSCSPGDPLV 37 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +2 Query: 11 KLVDPPGCRNR-HEAKGVGIPPTQ 79 +LVDPPGCRN H+A I Q Sbjct: 14 ELVDPPGCRNSIHKALDAAIDKIQ 37 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 140 PSSNSCSPGDPLV 152 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +2 Query: 11 KLVDPPGCRNRHEAKGVGIPPTQPPPSDNTANNRKICSKIPK 136 +LVDPPGCRN + P P+ T ++K +K PK Sbjct: 14 ELVDPPGCRNSMK-PAAKKPKAAKKPAAKTTPSKK--AKSPK 52 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 15 PTSNSCSPGDPLV 27 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 20 PTSNSCSPGDPLV 32 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 1/15 (6%) Frame = -2 Query: 53 LPRA-DSCSPGDPLV 12 +PRA +SCSPGDPLV Sbjct: 7 MPRASNSCSPGDPLV 21 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 46 PTSNSCSPGDPLV 58 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 3/22 (13%) Frame = -2 Query: 68 VFLLP---LPRADSCSPGDPLV 12 VFL+P + ++SCSPGDPLV Sbjct: 2 VFLIPYFIMLASNSCSPGDPLV 23 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 5 PTSNSCSPGDPLV 17 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 65 FLLPLPRADSCSPGDPLV 12 FLLP ++SCSPGDPLV Sbjct: 20 FLLP---SNSCSPGDPLV 34 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 18 PASNSCSPGDPLV 30 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 68 VFLLPLPRADSCSPGDPLV 12 V LP ++SCSPGDPLV Sbjct: 155 VSALPPHLSNSCSPGDPLV 173 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 13 RSNSCSPGDPLV 24 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 875 RSNSCSPGDPLV 886 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 39 RSNSCSPGDPLV 50 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 11 KLVDPPGCRNRHEAKGVGIPPTQ 79 +LVDPPGCRN E P Q Sbjct: 14 ELVDPPGCRNSMENARTSSPGFQ 36 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 65 FLLPLPRADSCSPGDPLV 12 FL+ ++SCSPGDPLV Sbjct: 197 FLMYSSSSNSCSPGDPLV 214 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 56 PLPRADSCSPGDPLV 12 P+ ++SCSPGDPLV Sbjct: 6 PITISNSCSPGDPLV 20 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 66 RSNSCSPGDPLV 77 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 63 RSNSCSPGDPLV 74 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 19 PPSNSCSPGDPLV 31 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +2 Query: 11 KLVDPPGCRN--RHEAKGVGIPPTQP 82 +LVDPPGCRN + K P T P Sbjct: 14 ELVDPPGCRNSMKQRFKTKAKPATNP 39 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 558 RSNSCSPGDPLV 569 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 110 RSNSCSPGDPLV 121 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 6 RSNSCSPGDPLV 17 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 59 LPLPRADSCSPGDPLV 12 L L ++SCSPGDPLV Sbjct: 19 LALTTSNSCSPGDPLV 34 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 78 CVGGIPTPFASCRFLQPGGSTS 13 C + T A FLQPGGSTS Sbjct: 2 CSTAVDTSTACIEFLQPGGSTS 23 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 39 PPSNSCSPGDPLV 51 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 92 RSNSCSPGDPLV 103 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 20 RSNSCSPGDPLV 31 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = -2 Query: 65 FLLPLPRADSCSPGDPLV 12 +L+P+ ++SCSPGDPLV Sbjct: 7 YLIPMV-SNSCSPGDPLV 23 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/19 (63%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -2 Query: 65 FLLPLP-RADSCSPGDPLV 12 F LP +++SCSPGDPLV Sbjct: 7 FTCALPQKSNSCSPGDPLV 25 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 44 RSNSCSPGDPLV 55 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 11 RSNSCSPGDPLV 22 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 17 RSNSCSPGDPLV 28 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 322 RSNSCSPGDPLV 333 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 60 RSNSCSPGDPLV 71 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_24355| Best HMM Match : SAM_2 (HMM E-Value=3e-07) Length = 352 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 71 PTQPPPSDNTANNRKICSKIPKHQVCTMDR 160 P P P N++N +K +PKH V + R Sbjct: 208 PQLPRPRTNSSNKKKSAPPLPKHVVSPVKR 237 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 71 PPSNSCSPGDPLV 83 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 96 PPSNSCSPGDPLV 108 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 24 PGSNSCSPGDPLV 36 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 214 RSNSCSPGDPLV 225 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 11 PGSNSCSPGDPLV 23 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 19 RSNSCSPGDPLV 30 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 1 RSNSCSPGDPLV 12 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 35 RSNSCSPGDPLV 46 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -2 Query: 62 LLPLPRADSCSPGDPLV 12 ++P P ++SCSPGDPLV Sbjct: 10 IIPKP-SNSCSPGDPLV 25 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 Query: 68 VFLLPLPRADSCSPGDPLV 12 +F + L ++SCSPGDPLV Sbjct: 139 LFSINLITSNSCSPGDPLV 157 >SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 71 PTQPPPSDNTANNRKICSKIPKHQVCTMDR 160 P P P N++N +K +PKH V + R Sbjct: 208 PQLPRPRTNSSNKKKSAPPLPKHVVSPVKR 237 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 68 VFLLPLPRADSCSPGDPLV 12 V+L LP ++SCSPGDPLV Sbjct: 20 VWLQLLP-SNSCSPGDPLV 37 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 29 PVSNSCSPGDPLV 41 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 53 LPRADSCSPGDPLV 12 L +++SCSPGDPLV Sbjct: 60 LSQSNSCSPGDPLV 73 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 68 VFLLPLPRADSCSPGDPLV 12 + ++P ++SCSPGDPLV Sbjct: 52 LIVVPSSISNSCSPGDPLV 70 >SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 63 PTPFASCRFLQPGGSTS 13 PT A+ FLQPGGSTS Sbjct: 37 PTLRANIEFLQPGGSTS 53 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 62 LLPLPRADSCSPGDPLV 12 +L L ++SCSPGDPLV Sbjct: 1 MLNLLASNSCSPGDPLV 17 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = -2 Query: 68 VFLLPLPRADSCSPGDPLV 12 V++ + +++SCSPGDPLV Sbjct: 17 VYINIIRQSNSCSPGDPLV 35 >SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 623 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 88 RWRLCRRYSYSLCLVPIPA 32 +WR+C R+ + LVPIPA Sbjct: 355 QWRVCLRFCSAYGLVPIPA 373 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 2 PVSNSCSPGDPLV 14 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 63 PVSNSCSPGDPLV 75 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 56 PLPRADSCSPGDPLV 12 P+ ++SCSPGDPLV Sbjct: 63 PILPSNSCSPGDPLV 77 >SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 60 TPFASCRFLQPGGSTS 13 TP ++ FLQPGGSTS Sbjct: 48 TPKSTIEFLQPGGSTS 63 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 58 PVSNSCSPGDPLV 70 >SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 60 TPFASCRFLQPGGSTS 13 +PF FLQPGGSTS Sbjct: 5 SPFRFIEFLQPGGSTS 20 >SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 69 GIPTPFASCRFLQPGGSTS 13 G P S FLQPGGSTS Sbjct: 30 GTRAPDGSIEFLQPGGSTS 48 >SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 63 PTPFASCRFLQPGGSTS 13 P P + FLQPGGSTS Sbjct: 33 PIPDTNIEFLQPGGSTS 49 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 59 LPLPRADSCSPGDPLV 12 L L ++SCSPGDPLV Sbjct: 6 LSLRASNSCSPGDPLV 21 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 11 KLVDPPGCRNRHE 49 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSME 26 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 11 KLVDPPGCRNRHEAK 55 +LVDPPGCRN + K Sbjct: 14 ELVDPPGCRNSMKMK 28 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 11 KLVDPPGCRNRHEAKGVGIPP 73 +LVDPPGCRN V + P Sbjct: 101 ELVDPPGCRNSITGGPVSMEP 121 >SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.1 bits (57), Expect = 8.8 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -2 Query: 131 VSWNIFFCY*QCYQKVEAV*EVFLLPLPRADSCSPGDPLV 12 + WN+ C + + + E++L ++SCSPGDPLV Sbjct: 19 IVWNV--CVTRRILEAPSEVELYLDICHTSNSCSPGDPLV 56 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 89 KVEAV*EVFLLPLPRADSCSPGDPLV 12 K AV ++ + ++SCSPGDPLV Sbjct: 57 KSSAVSALYRYVMTPSNSCSPGDPLV 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,299,672 Number of Sequences: 59808 Number of extensions: 308658 Number of successful extensions: 2171 Number of sequences better than 10.0: 157 Number of HSP's better than 10.0 without gapping: 2139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2169 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -