BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0132 (504 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13646-1|AAC24418.2| 2585|Caenorhabditis elegans Hypothetical pr... 29 1.4 Z98877-1|CAB11569.2| 343|Caenorhabditis elegans Hypothetical pr... 27 7.7 >U13646-1|AAC24418.2| 2585|Caenorhabditis elegans Hypothetical protein ZK783.1 protein. Length = 2585 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 5/68 (7%) Frame = +2 Query: 8 SKLVDPPG-----CRNRHEAKGVGIPPTQPPPSDNTANNRKICSKIPKHQVCTMDRAQII 172 +K V+ PG C N G PT P D+T +++ CS+ + C +D + Sbjct: 1508 AKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSE--SNMSCEVD---TV 1562 Query: 173 NGALESKE 196 +G++E KE Sbjct: 1563 DGSVECKE 1570 >Z98877-1|CAB11569.2| 343|Caenorhabditis elegans Hypothetical protein Y69H2.1 protein. Length = 343 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -3 Query: 178 PIYYLSSVHSTYLMFRYLGTYFSVI-SSVIRRWRLCRRYSYSLCLVPI 38 P Y LS+ + YL+F Y SV+ S++R + L S L VPI Sbjct: 96 PFYLLSTWQTMYLLFGKAPEYPSVLHCSLLRHFVLACFQSAGLITVPI 143 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,555,043 Number of Sequences: 27780 Number of extensions: 235773 Number of successful extensions: 745 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -