BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0131 (511 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.16c ||SPBC8E4.06|copper amine oxidase |Schizosaccharomy... 26 3.8 SPBC1734.03 ||SPBC337.19|dihydropteroatesynthase/2-amino-4-hydro... 25 8.7 SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces po... 25 8.7 >SPBC1289.16c ||SPBC8E4.06|copper amine oxidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 794 Score = 25.8 bits (54), Expect = 3.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 153 FGYNIDGVIYTSDSDFEHKRGSFTFKDELLEDHEK 257 F +GVI+ D+DF + RG T + HE+ Sbjct: 324 FTCGCEGVIHYMDADFVNYRGEITTIKNAISIHEE 358 >SPBC1734.03 ||SPBC337.19|dihydropteroatesynthase/2-amino-4-hydroxy- 6- hydroxymethyldihydropteridinediphosphokinase/dihydroneop terinaldolase|Schizosaccharomyces pombe|chr 2|||Manual Length = 686 Score = 24.6 bits (51), Expect = 8.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 147 KLFGYNIDGVIYTSDSDFEHKRGSFTFKDELLEDHEKI 260 KL I+G +T+ D +K S F+D + H I Sbjct: 62 KLLRKEIEGSFFTTPKDLVNKIASLCFEDVIDTSHVSI 99 >SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 472 Score = 24.6 bits (51), Expect = 8.7 Identities = 16/82 (19%), Positives = 32/82 (39%), Gaps = 1/82 (1%) Frame = +3 Query: 120 NKYKRSRQWKLFGYNIDGVIYTSDSDFEH-KRGSFTFKDELLEDHEKILIRKNLVPNHIN 296 + Y W + Y+ + + +D + +R S F + L H +PN ++ Sbjct: 182 HSYNVVNGWYSYCYHSLNKLQSKKTDLDDDERSSVEFYEHCLNHHGNTYPENLTIPNALD 241 Query: 297 YLFRTIIPIPRTRPESYSDQIH 362 +LF + P + +IH Sbjct: 242 FLFMPSLCYQLYYPRTAHVRIH 263 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,900,422 Number of Sequences: 5004 Number of extensions: 36595 Number of successful extensions: 94 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -