BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0131 (511 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52461| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.10 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.42 SB_7912| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.96 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.96 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.96 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.96 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.96 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.96 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_20669| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 29 2.2 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 29 2.9 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 29 2.9 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_13836| Best HMM Match : HEAT (HMM E-Value=0.39) 29 2.9 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 5.1 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 28 5.1 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 28 5.1 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 5.1 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 6.8 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 6.8 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 6.8 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 27 6.8 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 27 6.8 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 27 6.8 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_18229| Best HMM Match : RVT_1 (HMM E-Value=0.82) 27 9.0 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_58058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 27 9.0 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 27 9.0 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 >SB_52461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 398 Score = 33.5 bits (73), Expect = 0.10 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Frame = +3 Query: 192 SDFEHKRGSFTFKDELLEDHEKILIRKNLVPNHINYLFRTIIPIP---RTRPESYSDQIH 362 +DF+++ F +L + L+R+N++ N I++L T +P ++ PE + +I+ Sbjct: 16 NDFKNRENDLVFGRTILPSDRRYLLRENVLENRISFLVETWFRMPFGIKSAPEEFQRRIN 75 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 31.5 bits (68), Expect = 0.42 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 80 QYYE*HVHIKGPRADSCSPGDPLV 9 ++ E H I R++SCSPGDPLV Sbjct: 546 EWVEEHSKILSDRSNSCSPGDPLV 569 >SB_7912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1020 Score = 31.1 bits (67), Expect = 0.55 Identities = 17/59 (28%), Positives = 33/59 (55%) Frame = +3 Query: 138 RQWKLFGYNIDGVIYTSDSDFEHKRGSFTFKDELLEDHEKILIRKNLVPNHINYLFRTI 314 ++W + +++ S F K+GS T + + E HEK KNL+P+++ L++T+ Sbjct: 256 QEWLICLSVYTSLLHCRPSAFVAKKGSGTRESGVRESHEKSR-AKNLIPDYVLCLWQTL 313 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 30.7 bits (66), Expect = 0.73 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 65 HVHIKGPRADSCSPGDPLV 9 HV + G ++SCSPGDPLV Sbjct: 1014 HVFVVGLGSNSCSPGDPLV 1032 >SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.7 bits (66), Expect = 0.73 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = -2 Query: 123 YYVRSSYHKGIVGLTILRVAR----SY*RPSCRFLQPGGSTS 10 Y ++ Y + ILRVA RP+ FLQPGGSTS Sbjct: 26 YLLKRGYKPAFLKRQILRVANISRIDALRPNIEFLQPGGSTS 67 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 0.96 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 PR++SCSPGDPLV Sbjct: 2 PRSNSCSPGDPLV 14 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 0.96 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 PR++SCSPGDPLV Sbjct: 21 PRSNSCSPGDPLV 33 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 0.96 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 71 E*HVHIKGPRADSCSPGDPLV 9 E V ++ P ++SCSPGDPLV Sbjct: 7 ESRVGVRTPTSNSCSPGDPLV 27 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 0.96 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 PR++SCSPGDPLV Sbjct: 68 PRSNSCSPGDPLV 80 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 0.96 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 PR++SCSPGDPLV Sbjct: 16 PRSNSCSPGDPLV 28 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 0.96 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 GP ++SCSPGDPLV Sbjct: 17 GPASNSCSPGDPLV 30 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = -3 Query: 62 VHIKGPRADSCSPGDPLV 9 +++K R++SCSPGDPLV Sbjct: 6 LYVKLERSNSCSPGDPLV 23 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 GP ++SCSPGDPLV Sbjct: 18 GPPSNSCSPGDPLV 31 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 +G R++SCSPGDPLV Sbjct: 28 RGGRSNSCSPGDPLV 42 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 56 IKGPRADSCSPGDPLV 9 +K R++SCSPGDPLV Sbjct: 6 VKRTRSNSCSPGDPLV 21 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 59 HIKGPRADSCSPGDPLV 9 H+K ++SCSPGDPLV Sbjct: 1 HLKKRSSNSCSPGDPLV 17 >SB_20669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 56 IKGPRADSCSPGDPLV 9 +KG ++SCSPGDPLV Sbjct: 2 LKGDGSNSCSPGDPLV 17 >SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.1 bits (62), Expect = 2.2 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = -2 Query: 162 CSRIISIDATSCIYYVRSSYHKGIVGLTILRVARSY*RPSCRFLQPGGSTS 10 C+R+ SI+ TS + Y G+ GL ++ + FLQPGGSTS Sbjct: 2 CTRVTSIETTSVPRELHEVYEDGM-GLRYEQII-TIRHFVIEFLQPGGSTS 50 >SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) Length = 141 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 56 IKGPRADSCSPGDPLV 9 I+G ++SCSPGDPLV Sbjct: 13 IRGHSSNSCSPGDPLV 28 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 K R++SCSPGDPLV Sbjct: 23 KSKRSNSCSPGDPLV 37 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 K R++SCSPGDPLV Sbjct: 23 KATRSNSCSPGDPLV 37 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 8 KLVDPPGCRNRHEG 49 +LVDPPGCRN EG Sbjct: 14 ELVDPPGCRNSIEG 27 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 G R++SCSPGDPLV Sbjct: 23 GHRSNSCSPGDPLV 36 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -3 Query: 65 HVHIKGPRA--DSCSPGDPLV 9 H HIK + +SCSPGDPLV Sbjct: 1 HEHIKDAESTSNSCSPGDPLV 21 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 65 HVHIKGPRADSCSPGDPLV 9 HV I+ ++SCSPGDPLV Sbjct: 86 HVVIEWVLSNSCSPGDPLV 104 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 80 QYYE*HVHIKGPRADSCSPGDPLV 9 +Y + H ++ ++SCSPGDPLV Sbjct: 470 RYIQAHPILEAGASNSCSPGDPLV 493 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 87 GLTILRVARSY*RPSCRFLQPGGSTS 10 G ++R ++ P+ FLQPGGSTS Sbjct: 133 GFRMVRATKNRYGPAIEFLQPGGSTS 158 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 K R++SCSPGDPLV Sbjct: 5 KSRRSNSCSPGDPLV 19 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 2.9 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P+++SCSPGDPLV Sbjct: 30 PQSNSCSPGDPLV 42 >SB_13836| Best HMM Match : HEAT (HMM E-Value=0.39) Length = 400 Score = 28.7 bits (61), Expect = 2.9 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +3 Query: 213 GSFTFKDELLEDHEKILIRKNLVPNHINYLFRTIIPIPRT 332 G++ +++ L +E IL K L+ NHI+YLF T +PRT Sbjct: 306 GAWEWREGRLLAYELIL--KFLIANHIHYLFPT-FALPRT 342 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 G R++SCSPGDPLV Sbjct: 3 GLRSNSCSPGDPLV 16 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 K R++SCSPGDPLV Sbjct: 18 KNLRSNSCSPGDPLV 32 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 K R++SCSPGDPLV Sbjct: 36 KNYRSNSCSPGDPLV 50 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 K R++SCSPGDPLV Sbjct: 4 KKSRSNSCSPGDPLV 18 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 71 E*HVHIKGPRADSCSPGDPLV 9 E HV + ++SCSPGDPLV Sbjct: 1 ECHVSLSLRASNSCSPGDPLV 21 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 80 QYYE*HVHIKGPRADSCSPGDPLV 9 +YY + K R++SCSPGDPLV Sbjct: 202 RYYGSAQNGKHLRSNSCSPGDPLV 225 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = -3 Query: 65 HVHIKGPR--ADSCSPGDPLV 9 H+ KG + ++SCSPGDPLV Sbjct: 21 HIQKKGAKEISNSCSPGDPLV 41 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 59 HIKGPRADSCSPGDPLV 9 H G ++SCSPGDPLV Sbjct: 7 HESGLTSNSCSPGDPLV 23 >SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 KGP ++SCSPGDPLV Sbjct: 17 KGP-SNSCSPGDPLV 30 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 51 RPSCRFLQPGGSTS 10 +PS FLQPGGSTS Sbjct: 22 KPSIEFLQPGGSTS 35 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 9 PASNSCSPGDPLV 21 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 56 IKGPRADSCSPGDPLV 9 ++ P ++SCSPGDPLV Sbjct: 21 VEFPGSNSCSPGDPLV 36 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 8 KLVDPPGCRNRHEGL*YERATRNIVKPTIP 97 +LVDPPGCRN + ++ + KP +P Sbjct: 14 ELVDPPGCRNSIDINDMKQLFECVGKPVVP 43 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 140 PSSNSCSPGDPLV 152 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 65 HVHIKGPRADSCSPGDPLV 9 H+ K ++SCSPGDPLV Sbjct: 35 HLSHKRSSSNSCSPGDPLV 53 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 20 PTSNSCSPGDPLV 32 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 8 KLVDPPGCRNRHEGL*YERATRNIVKPT 91 +LVDPPGCRN + + +T++ K T Sbjct: 14 ELVDPPGCRNSMDDIALLSSTKDREKKT 41 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 62 VHIKGPRADSCSPGDPLV 9 ++ + P ++SCSPGDPLV Sbjct: 34 INPRKPPSNSCSPGDPLV 51 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 56 IKGPRADSCSPGDPLV 9 I+ R++SCSPGDPLV Sbjct: 60 IRLSRSNSCSPGDPLV 75 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 Query: 8 KLVDPPGCRNRHEG 49 +LVDPPGCRN +G Sbjct: 31 ELVDPPGCRNSIDG 44 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 46 PTSNSCSPGDPLV 58 >SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 51 RPSCRFLQPGGSTS 10 RP+ FLQPGGSTS Sbjct: 70 RPTIEFLQPGGSTS 83 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 + R++SCSPGDPLV Sbjct: 4 RNERSNSCSPGDPLV 18 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 5 PTSNSCSPGDPLV 17 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 182 PPSNSCSPGDPLV 194 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 80 QYYE*HVHIKGPRADSCSPGDPLV 9 ++ E VH ++SCSPGDPLV Sbjct: 66 EHTEAEVHWGEGTSNSCSPGDPLV 89 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 16 PPSNSCSPGDPLV 28 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 381 RSNSCSPGDPLV 392 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 13 RSNSCSPGDPLV 24 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 63 PLSNSCSPGDPLV 75 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 875 RSNSCSPGDPLV 886 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 51 RPSCRFLQPGGSTS 10 RP FLQPGGSTS Sbjct: 39 RPDIEFLQPGGSTS 52 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 66 RSNSCSPGDPLV 77 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 56 IKGPRADSCSPGDPLV 9 I+ +++SCSPGDPLV Sbjct: 18 IQARKSNSCSPGDPLV 33 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 16 PLSNSCSPGDPLV 28 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 63 RSNSCSPGDPLV 74 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 110 RSNSCSPGDPLV 121 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 6 RSNSCSPGDPLV 17 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 92 RSNSCSPGDPLV 103 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 20 RSNSCSPGDPLV 31 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 44 RSNSCSPGDPLV 55 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 11 RSNSCSPGDPLV 22 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 138 PGSNSCSPGDPLV 150 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 17 RSNSCSPGDPLV 28 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 45 RSNSCSPGDPLV 56 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 59 RSNSCSPGDPLV 70 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 322 RSNSCSPGDPLV 333 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 60 RSNSCSPGDPLV 71 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 80 QYYE*HVHIKGPRADSCSPGDPLV 9 +Y+E + + ++SCSPGDPLV Sbjct: 6 KYFEPDSNQRPRESNSCSPGDPLV 29 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 G ++SCSPGDPLV Sbjct: 51 GSESNSCSPGDPLV 64 >SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 72 RVARSY*RPSCRFLQPGGSTS 10 R RS R S FLQPGGSTS Sbjct: 3 RQHRSLTRRSIEFLQPGGSTS 23 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 71 PPSNSCSPGDPLV 83 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 55 RSNSCSPGDPLV 66 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 96 PPSNSCSPGDPLV 108 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 24 PGSNSCSPGDPLV 36 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 62 VHIKGPRADSCSPGDPLV 9 + +K ++SCSPGDPLV Sbjct: 10 IDLKSLTSNSCSPGDPLV 27 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 11 PGSNSCSPGDPLV 23 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 19 RSNSCSPGDPLV 30 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 1 RSNSCSPGDPLV 12 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 35 RSNSCSPGDPLV 46 >SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 +G ++SCSPGDPLV Sbjct: 9 RGVSSNSCSPGDPLV 23 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -3 Query: 44 RADSCSPGDPLV 9 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 29 PVSNSCSPGDPLV 41 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 105 YHKGIVGL-TILRVARSY*RPS-CRFLQPGGSTS 10 YH+ L T++ + Y P FLQPGGSTS Sbjct: 408 YHEAFSRLVTVVHITPCYVTPRHIEFLQPGGSTS 441 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 8 KLVDPPGCRNRHE 46 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSME 26 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 G ++SCSPGDPLV Sbjct: 14 GKTSNSCSPGDPLV 27 >SB_18229| Best HMM Match : RVT_1 (HMM E-Value=0.82) Length = 458 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 255 KILIRKNLVPNHINYLFRT 311 K L+R+NL+ NHI Y+ +T Sbjct: 346 KRLLRENLIYNHIKYVLKT 364 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/14 (85%), Positives = 13/14 (92%), Gaps = 1/14 (7%) Frame = -3 Query: 47 PRA-DSCSPGDPLV 9 PRA +SCSPGDPLV Sbjct: 8 PRASNSCSPGDPLV 21 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 G ++SCSPGDPLV Sbjct: 12 GKASNSCSPGDPLV 25 >SB_58058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 255 KILIRKNLVPNHINYLFRT 311 K L+R+NL+ NHI Y+ +T Sbjct: 261 KRLLRENLIYNHIKYVLKT 279 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 2 PVSNSCSPGDPLV 14 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 63 PVSNSCSPGDPLV 75 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 G ++SCSPGDPLV Sbjct: 25 GKTSNSCSPGDPLV 38 >SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 62 VHIKGPRADSCSPGDPLV 9 V G ++SCSPGDPLV Sbjct: 16 VEAAGVGSNSCSPGDPLV 33 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 53 KGPRADSCSPGDPLV 9 KG ++SCSPGDPLV Sbjct: 971 KGWISNSCSPGDPLV 985 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 47 PRADSCSPGDPLV 9 P ++SCSPGDPLV Sbjct: 58 PVSNSCSPGDPLV 70 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -3 Query: 416 TTSPLQLKLTYALSYL*RMNLIRI-----RFRPCPRNRY 315 T P + TY Y R NL+R+ ++RPC R Y Sbjct: 519 TVKPFRAPSTYGTEYSGRANLLRLSTIQPKYRPCRRLTY 557 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 8 KLVDPPGCRNRHE 46 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSME 26 >SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 50 GPRADSCSPGDPLV 9 G +++SCSPGDPLV Sbjct: 2 GLQSNSCSPGDPLV 15 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,993,177 Number of Sequences: 59808 Number of extensions: 268865 Number of successful extensions: 2216 Number of sequences better than 10.0: 144 Number of HSP's better than 10.0 without gapping: 2160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2214 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -