BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0129 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 30 1.9 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_46154| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-27) 29 4.4 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 29 4.4 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 28 5.8 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 28 5.8 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 7.6 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 28 7.6 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 28 7.6 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 7.6 SB_14471| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_3043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 PR++SCSPGDPLV Sbjct: 2 PRSNSCSPGDPLV 14 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 PR++SCSPGDPLV Sbjct: 21 PRSNSCSPGDPLV 33 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 PR++SCSPGDPLV Sbjct: 68 PRSNSCSPGDPLV 80 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 PR++SCSPGDPLV Sbjct: 16 PRSNSCSPGDPLV 28 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 +K R++SCSPGDPLV Sbjct: 6 VKRTRSNSCSPGDPLV 21 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 360 YGYDYQPPRHYTE-RRDYYQNQQDLIPQIF 446 Y Y Y+ PRHYTE R + + N D+ +F Sbjct: 750 YSYLYELPRHYTECRTELWLNNTDMRGSVF 779 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 I E R++SCSPGDPLV Sbjct: 20 IVEKRSNSCSPGDPLV 35 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/15 (66%), Positives = 15/15 (100%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 ++P+++SCSPGDPLV Sbjct: 28 RKPQSNSCSPGDPLV 42 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -3 Query: 61 IIKEPRADSCSPGDPLV 11 I++ P ++SCSPGDPLV Sbjct: 20 IVEFPGSNSCSPGDPLV 36 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 ++ P ++SCSPGDPLV Sbjct: 12 VRTPTSNSCSPGDPLV 27 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 K+ R++SCSPGDPLV Sbjct: 4 KKSRSNSCSPGDPLV 18 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 +K R++SCSPGDPLV Sbjct: 8 VKLERSNSCSPGDPLV 23 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 K R++SCSPGDPLV Sbjct: 23 KSKRSNSCSPGDPLV 37 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 ++E +++SCSPGDPLV Sbjct: 17 LQEKKSNSCSPGDPLV 32 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 100 PLTRHSCS*VNC*IIKEPRADSCSPGDPLV 11 P+ + S S V ++ + ++SCSPGDPLV Sbjct: 11 PVAKDSSSPVLLKLVLQGLSNSCSPGDPLV 40 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 70 NC*IIKEPRADSCSPGDPLV 11 +C R++SCSPGDPLV Sbjct: 2 SCTYFMHTRSNSCSPGDPLV 21 >SB_46154| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-27) Length = 799 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 315 YPTLNRHRRRRWQLNYGYDYQPPRHYTERRDYYQ 416 Y TLN+ R+ Y Y+YQ + DYYQ Sbjct: 413 YSTLNQEHRQNRNDYYSYNYQRASSESRSFDYYQ 446 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 ++ R++SCSPGDPLV Sbjct: 107 RDQRSNSCSPGDPLV 121 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 K R++SCSPGDPLV Sbjct: 5 KSRRSNSCSPGDPLV 19 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 61 IIKEPRADSCSPGDPLV 11 II R++SCSPGDPLV Sbjct: 20 IIAVRRSNSCSPGDPLV 36 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 ++P ++SCSPGDPLV Sbjct: 37 RKPPSNSCSPGDPLV 51 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 I +P ++SCSPGDPLV Sbjct: 43 IFKPTSNSCSPGDPLV 58 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 K R++SCSPGDPLV Sbjct: 23 KATRSNSCSPGDPLV 37 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 61 IIKEPRADSCSPGDPLV 11 + E R++SCSPGDPLV Sbjct: 9 VTDEIRSNSCSPGDPLV 25 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 61 IIKEPRADSCSPGDPLV 11 ++ P ++SCSPGDPLV Sbjct: 12 VLHVPPSNSCSPGDPLV 28 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 K R++SCSPGDPLV Sbjct: 18 KNLRSNSCSPGDPLV 32 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 52 EPRADSCSPGDPLV 11 +P ++SCSPGDPLV Sbjct: 62 QPLSNSCSPGDPLV 75 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/16 (75%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = +1 Query: 10 KLVDPPGCRNR-HEAL 54 +LVDPPGCRN H+AL Sbjct: 14 ELVDPPGCRNSIHKAL 29 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 K R++SCSPGDPLV Sbjct: 36 KNYRSNSCSPGDPLV 50 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 ++ R++SCSPGDPLV Sbjct: 63 RQGRSNSCSPGDPLV 77 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/15 (80%), Positives = 13/15 (86%), Gaps = 1/15 (6%) Frame = +1 Query: 10 KLVDPPGCRNR-HEA 51 +LVDPPGCRN HEA Sbjct: 14 ELVDPPGCRNSIHEA 28 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 67 C*IIKEPRADSCSPGDPLV 11 C +I ++SCSPGDPLV Sbjct: 19 CAVIMRITSNSCSPGDPLV 37 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 I+ R++SCSPGDPLV Sbjct: 60 IRLSRSNSCSPGDPLV 75 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 ++ R++SCSPGDPLV Sbjct: 41 RKKRSNSCSPGDPLV 55 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 52 EPRADSCSPGDPLV 11 E R++SCSPGDPLV Sbjct: 9 EIRSNSCSPGDPLV 22 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 61 IIKEPRADSCSPGDPLV 11 ++ R++SCSPGDPLV Sbjct: 40 LVDPARSNSCSPGDPLV 56 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 61 IIKEPRADSCSPGDPLV 11 ++ R++SCSPGDPLV Sbjct: 3 VVSFARSNSCSPGDPLV 19 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 52 EPRADSCSPGDPLV 11 +P ++SCSPGDPLV Sbjct: 95 QPPSNSCSPGDPLV 108 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 K R++SCSPGDPLV Sbjct: 211 KHLRSNSCSPGDPLV 225 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 P ++SCSPGDPLV Sbjct: 9 PASNSCSPGDPLV 21 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 P ++SCSPGDPLV Sbjct: 140 PSSNSCSPGDPLV 152 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 +K+ ++SCSPGDPLV Sbjct: 237 LKKKTSNSCSPGDPLV 252 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 P ++SCSPGDPLV Sbjct: 20 PTSNSCSPGDPLV 32 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 58 IKEPRADSCSPGDPLV 11 I R++SCSPGDPLV Sbjct: 554 ILSDRSNSCSPGDPLV 569 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 10 KLVDPPGCRNRHEAL*LFNS 69 +LVDPPGCRN + + L +S Sbjct: 14 ELVDPPGCRNSMDDIALLSS 33 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 52 EPRADSCSPGDPLV 11 +P ++SCSPGDPLV Sbjct: 1 DPVSNSCSPGDPLV 14 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/16 (75%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = -3 Query: 55 KEP-RADSCSPGDPLV 11 K P R++SCSPGDPLV Sbjct: 13 KRPHRSNSCSPGDPLV 28 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 + R++SCSPGDPLV Sbjct: 4 RNERSNSCSPGDPLV 18 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 P ++SCSPGDPLV Sbjct: 5 PTSNSCSPGDPLV 17 >SB_14471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -1 Query: 357 LVAISSYGVCLGSGNLFLS*SRFVRHHLQNFQSLFCRHNAV 235 +VAIS V + SGNL + S V LQN S+F AV Sbjct: 24 VVAISFLAVAIFSGNLLVIVSVAVNRRLQNKTSVFITSLAV 64 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 55 KEPRADSCSPGDPLV 11 + P ++SCSPGDPLV Sbjct: 9 ERPGSNSCSPGDPLV 23 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 49 PRADSCSPGDPLV 11 P ++SCSPGDPLV Sbjct: 18 PASNSCSPGDPLV 30 >SB_3043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 777 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 493 RPHHRSQFTFHTQCP-ITCLNTFRVMSTRQRS 585 +PHHRS FT T P + +FR+ R RS Sbjct: 494 KPHHRSVFTSPTIVPSLRAPTSFRLYKPRHRS 525 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 52 EPRADSCSPGDPLV 11 E +++SCSPGDPLV Sbjct: 4 EKKSNSCSPGDPLV 17 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,444,851 Number of Sequences: 59808 Number of extensions: 346775 Number of successful extensions: 2195 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 2156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2195 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -