BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0129 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g09700.1 68417.m01594 hypothetical protein similar to zinc fi... 31 0.51 At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative simila... 29 2.0 At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative simila... 29 2.0 At3g42180.1 68416.m04335 exostosin family protein contains Pfam ... 28 6.2 At1g47790.1 68414.m05317 F-box family protein contains Pfam:PF00... 28 6.2 At5g47450.1 68418.m05853 major intrinsic family protein / MIP fa... 27 8.2 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 27 8.2 >At4g09700.1 68417.m01594 hypothetical protein similar to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 371 Score = 31.5 bits (68), Expect = 0.51 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Frame = +3 Query: 288 QSDFKKERDYPTLNRHRRRRWQLNYG------YDYQPPRHYTERRDYYQNQQDLIP 437 +SD +++ DYP+ HR R + ++ DY P Y RRD ++ DL P Sbjct: 278 RSDHREKSDYPSAYSHRHREPRRDFSPQDCSRRDYSRPASYNFRRDSVRSGFDLHP 333 >At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative similar to ATP-dependent RNA helicases Length = 505 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 348 WQLNYGYDYQPPRHYTERRDYYQNQQDLIPQ 440 +Q GY PP Y +R +Y QN Q Q Sbjct: 24 YQSRSGYQQHPPPQYVQRGNYAQNHQQQFQQ 54 >At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative similar to ATP-dependent RNA helicases Length = 505 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 348 WQLNYGYDYQPPRHYTERRDYYQNQQDLIPQ 440 +Q GY PP Y +R +Y QN Q Q Sbjct: 24 YQSRSGYQQHPPPQYVQRGNYAQNHQQQFQQ 54 >At3g42180.1 68416.m04335 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 425 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 502 HRSQFTFHTQCPITCLNTFRVMSTRQRSRTLNKDSPI 612 +R+ F FH Q I + TF+V S ++ + L D P+ Sbjct: 72 YRNSFAFH-QSHIEMMKTFKVWSYKEGEQPLVHDGPV 107 >At1g47790.1 68414.m05317 F-box family protein contains Pfam:PF00646 F-box domain Length = 389 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 389 LYRKKRLLSKPTGSDPSDI 445 +YR++RL SKPT S P D+ Sbjct: 11 VYRRRRLQSKPTSSFPLDL 29 >At5g47450.1 68418.m05853 major intrinsic family protein / MIP family protein contains Pfam profile: MIP PF00230 Length = 250 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 640 NPQFWFVSSISGNLCLMSGFFVWL 569 NP +I GN+ L++GFF W+ Sbjct: 83 NPAVTLGLAIGGNITLITGFFYWI 106 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 345 RWQLNYGYDYQPPRHYTERRDYYQNQQDLIPQIFRLLDELAVEVRR 482 R+Q ++G + + P+ YT R + +Q D + R+ + L EV+R Sbjct: 1271 RYQDSHGTEGESPQRYTSRLERHQRTADRV----RIAETLDTEVKR 1312 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,753,702 Number of Sequences: 28952 Number of extensions: 232311 Number of successful extensions: 449 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -