BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0128 (364 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70287-3|CAA94300.1| 1459|Caenorhabditis elegans Hypothetical pr... 27 5.3 AF016441-2|AAB65912.2| 417|Caenorhabditis elegans Hypothetical ... 26 7.0 Z72515-5|CAH60771.2| 331|Caenorhabditis elegans Hypothetical pr... 26 9.3 >Z70287-3|CAA94300.1| 1459|Caenorhabditis elegans Hypothetical protein R09E10.5 protein. Length = 1459 Score = 26.6 bits (56), Expect = 5.3 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -3 Query: 110 LKNTPFYFMQFRSFSFRYKDASCRIPAARGSTSLER 3 + N F F Q F+F Y S R P R T LER Sbjct: 876 IDNDKFIFNQPGVFNFLYIPQSVRTPEVRIQTRLER 911 >AF016441-2|AAB65912.2| 417|Caenorhabditis elegans Hypothetical protein M03F8.5 protein. Length = 417 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = -3 Query: 155 VPASVFLFYVINTSILKNTPFYFMQFRSFSFRYKDA 48 + + + LFY+++ S L P ++FR+FS ++ A Sbjct: 16 ITSLICLFYIVSQSHLNFKPNLKLEFRNFSEPHRQA 51 >Z72515-5|CAH60771.2| 331|Caenorhabditis elegans Hypothetical protein T11A5.7 protein. Length = 331 Score = 25.8 bits (54), Expect = 9.3 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = -1 Query: 142 YSFFML*IQVFLKTHPFILCNSGAFHLGIKMPRAEFLQPGDPLV*SA 2 Y + VFL P ++ S G+ MP PG P + +A Sbjct: 141 YGILFASLHVFLAAAPLMIAYSNTKFDGVFMPYCNIYMPGHPEIANA 187 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,920,043 Number of Sequences: 27780 Number of extensions: 147082 Number of successful extensions: 266 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 266 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 503476126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -