BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0122 (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 24 1.5 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 24 1.5 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 24 1.5 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 1.5 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 24 1.5 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 24 1.5 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 24 1.5 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 24 1.5 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 2.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 6.2 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 8.2 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 404 YQNAMNKYINIYFRLQEYNVI 466 Y N N Y Y +LQ YN+I Sbjct: 94 YNNYNNNYNTNYKKLQYYNII 114 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 404 YQNAMNKYINIYFRLQEYNVI 466 Y N N Y Y +LQ YN+I Sbjct: 94 YNNYNNNYNTNYKKLQYYNII 114 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 404 YQNAMNKYINIYFRLQEYNVI 466 Y N N Y Y +LQ YN+I Sbjct: 94 YNNYNNNYNTNYKKLQYYNII 114 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 404 YQNAMNKYINIYFRLQEYNVI 466 Y N N Y Y +LQ YN+I Sbjct: 94 YNNYNNNYNTNYKKLQYYNII 114 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 404 YQNAMNKYINIYFRLQEYNVI 466 Y N N Y Y +LQ YN+I Sbjct: 94 YNNYNNNYNTNYKKLQYYNII 114 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 404 YQNAMNKYINIYFRLQEYNVI 466 Y N N Y Y +LQ YN+I Sbjct: 94 YNNYNNNYNTNYKKLQYYNII 114 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 404 YQNAMNKYINIYFRLQEYNVI 466 Y N N Y Y +LQ YN+I Sbjct: 98 YNNYNNNYNTNYKKLQYYNII 118 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 404 YQNAMNKYINIYFRLQEYNVI 466 Y N N Y Y +LQ YN+I Sbjct: 94 YNNYNNNYNTNYKKLQYYNII 114 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 377 CFLCNFVL*YQNAMNKYINIYFRLQE 454 C LC+ V N++N + +IY R Q+ Sbjct: 404 CALCHKVFRTLNSLNNHKSIYHRRQK 429 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 527 PKNLYTFNYVEVSDIFIKMSL*HYI 453 P +L + NY +SD+F+ L YI Sbjct: 105 PTSLGSENYTGISDLFVFDDLNDYI 129 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 565 LINWI*NTFARIYQKTCTHSTMLK*VTSLLKC 470 + NW NTF + T ++ SL KC Sbjct: 530 IYNWFQNTFCYFRRNAATWKNAVRHNLSLHKC 561 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 221 ISFFCYHLFSATCKT 177 + FFC ++ ++ CKT Sbjct: 286 VPFFCVNIVTSYCKT 300 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,921 Number of Sequences: 438 Number of extensions: 3657 Number of successful extensions: 15 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -