Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0119
         (490 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7RKI1 Cluster: Putative uncharacterized protein PY0292...    33   2.6  

>UniRef50_Q7RKI1 Cluster: Putative uncharacterized protein PY02920;
           n=5; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY02920 - Plasmodium yoelii yoelii
          Length = 1535

 Score = 33.5 bits (73), Expect = 2.6
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -3

Query: 284 LRASFKSNSNLNSPRRDIDILTSHFHFC-YLIKYKHLNLTPNFNYQLKS 141
           L  S + N N    ++  DI T++ HFC  +I Y   NL+PN  Y  K+
Sbjct: 146 LNKSIEKNKNFKKGKQGKDITTTYKHFCKRIINY---NLSPNLYYNYKN 191


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 364,682,664
Number of Sequences: 1657284
Number of extensions: 5881345
Number of successful extensions: 10129
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9925
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10125
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 28019067077
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)