BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0119 (490 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M83077-1|AAA58390.1| 288|Homo sapiens antigen B7 protein. 29 6.5 M27533-1|AAA36045.1| 288|Homo sapiens protein ( Human Ig rearra... 29 6.5 EF064750-1|ABK41933.1| 288|Homo sapiens CD80 molecule protein. 29 6.5 BC042665-1|AAH42665.1| 288|Homo sapiens CD80 molecule protein. 29 6.5 AY197777-1|AAO39208.1| 256|Homo sapiens costimulatory factor CD... 29 6.5 >M83077-1|AAA58390.1| 288|Homo sapiens antigen B7 protein. Length = 288 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 248 SPRRDIDILTSHFHFCYLIKYKHLNLTPNFNY 153 S + D ++ T+H C LIKY HL + FN+ Sbjct: 201 SSKLDFNMTTNHSFMC-LIKYGHLRVNQTFNW 231 >M27533-1|AAA36045.1| 288|Homo sapiens protein ( Human Ig rearranged B7 protein mRNA VC1-region, complete cds. ). Length = 288 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 248 SPRRDIDILTSHFHFCYLIKYKHLNLTPNFNY 153 S + D ++ T+H C LIKY HL + FN+ Sbjct: 201 SSKLDFNMTTNHSFMC-LIKYGHLRVNQTFNW 231 >EF064750-1|ABK41933.1| 288|Homo sapiens CD80 molecule protein. Length = 288 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 248 SPRRDIDILTSHFHFCYLIKYKHLNLTPNFNY 153 S + D ++ T+H C LIKY HL + FN+ Sbjct: 201 SSKLDFNMTTNHSFMC-LIKYGHLRVNQTFNW 231 >BC042665-1|AAH42665.1| 288|Homo sapiens CD80 molecule protein. Length = 288 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 248 SPRRDIDILTSHFHFCYLIKYKHLNLTPNFNY 153 S + D ++ T+H C LIKY HL + FN+ Sbjct: 201 SSKLDFNMTTNHSFMC-LIKYGHLRVNQTFNW 231 >AY197777-1|AAO39208.1| 256|Homo sapiens costimulatory factor CD80 type 1 protein. Length = 256 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 248 SPRRDIDILTSHFHFCYLIKYKHLNLTPNFNY 153 S + D ++ T+H C LIKY HL + FN+ Sbjct: 201 SSKLDFNMTTNHSFMC-LIKYGHLRVNQTFNW 231 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,361,568 Number of Sequences: 237096 Number of extensions: 780958 Number of successful extensions: 909 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 909 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4366354454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -