BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0119 (490 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50990.1 68416.m05583 peroxidase, putative similar to peroxid... 29 1.7 At5g44590.1 68418.m05464 hypothetical protein 28 3.9 At5g07380.1 68418.m00845 hypothetical protein 28 3.9 >At3g50990.1 68416.m05583 peroxidase, putative similar to peroxidase ATP6a [Arabidopsis thaliana] gi|1429215|emb|CAA67310 Length = 336 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 275 SFKSNSNLNSPRRDIDILTSHFHFCYL 195 S+ +N+ N PR IL HFH C++ Sbjct: 51 SYVANAYFNDPRMAASILRLHFHDCFV 77 >At5g44590.1 68418.m05464 hypothetical protein Length = 349 Score = 27.9 bits (59), Expect = 3.9 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 418 WVRGVTIAFSFE-YESFCLTVNSSCMVSI 335 WV V I F+FE Y+ FCL S+C+ I Sbjct: 108 WVN-VVIVFNFESYQHFCLKDESACLPPI 135 >At5g07380.1 68418.m00845 hypothetical protein Length = 595 Score = 27.9 bits (59), Expect = 3.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 284 LRASFKSNSNLNSPRRDIDILTSHFHFCYLIK 189 L+ SF SNL++ +D LT CY++K Sbjct: 21 LKQSFLKLSNLHAISSPVDSLTDRIGLCYILK 52 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,838,306 Number of Sequences: 28952 Number of extensions: 127265 Number of successful extensions: 224 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -