BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0116 (363 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0070 + 27479654-27479672,27479864-27479922,27480339-274803... 131 1e-31 01_06_0260 - 27959188-27959251,27959342-27959424,27960220-279603... 130 3e-31 07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753... 29 1.5 07_01_0385 - 2871628-2872131 28 2.6 12_02_0648 + 21490202-21490296,21490547-21490634,21491216-214912... 27 3.4 07_03_1237 + 25073010-25073513 27 6.0 09_06_0303 - 22149214-22149474,22150099-22150236,22150856-221511... 26 7.9 >05_07_0070 + 27479654-27479672,27479864-27479922,27480339-27480378, 27480477-27480565,27481065-27481147,27481219-27481282 Length = 117 Score = 131 bits (317), Expect = 1e-31 Identities = 57/89 (64%), Positives = 69/89 (77%) Frame = +2 Query: 32 KMAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKR 211 ++ KRTKK GI GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR VGIW CK Sbjct: 25 ELTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKD 84 Query: 212 CKRTVAGGAWVFSTTAASSCRSAVRRLRE 298 C + AGGA+ +T +A + RS +RRLRE Sbjct: 85 CGKVKAGGAYTMNTASAVTVRSTIRRLRE 113 >01_06_0260 - 27959188-27959251,27959342-27959424,27960220-27960308, 27960388-27960427,27960938-27960981,27961240-27961288 Length = 122 Score = 130 bits (314), Expect = 3e-31 Identities = 57/86 (66%), Positives = 67/86 (77%) Frame = +2 Query: 41 KRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKR 220 KRTKK GI GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR VGIW CK C + Sbjct: 33 KRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGK 92 Query: 221 TVAGGAWVFSTTAASSCRSAVRRLRE 298 AGGA+ +T +A + RS +RRLRE Sbjct: 93 VKAGGAYTMNTASAVTVRSTIRRLRE 118 >07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371, 18577344-18577458,18578179-18578333,18578673-18580621, 18580691-18581372,18581550-18581621,18582558-18583199, 18583301-18583402,18585011-18585100 Length = 2192 Score = 28.7 bits (61), Expect = 1.5 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 158 CGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAASSCRSAVRRLR 295 C +KR+ G W C RC+ + + A +S R RR+R Sbjct: 58 CLNPPLKRAPPGNWQCPRCRTKKVSLKLLDNADADTSKRERTRRMR 103 >07_01_0385 - 2871628-2872131 Length = 167 Score = 27.9 bits (59), Expect = 2.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 143 YTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAW 241 + C FC K K +G K VAGG+W Sbjct: 47 FPCLFCAKTFRKSQALGGHQNAHRKERVAGGSW 79 >12_02_0648 + 21490202-21490296,21490547-21490634,21491216-21491260, 21491355-21491387,21491480-21491557,21491647-21491690, 21491765-21491805,21492102-21492184,21492261-21492352, 21492468-21492537,21492838-21492876,21493670-21493687, 21494586-21494713,21495235-21495358,21495585-21495716, 21496092-21496223,21496582-21496665 Length = 441 Score = 27.5 bits (58), Expect = 3.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 122 EVTQHAKYTCSFCGKDAM 175 E+ +H KYTC C K A+ Sbjct: 194 EMVEHNKYTCPICSKTAL 211 >07_03_1237 + 25073010-25073513 Length = 167 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 176 KRSCVGIWSCKRCKRTVAGGAWVFSTTAASSC 271 KR G+ C C RT++GG++ + ++C Sbjct: 24 KRGAAGV--CNVCDRTISGGSYGYRCGGGAAC 53 >09_06_0303 - 22149214-22149474,22150099-22150236,22150856-22151100, 22151344-22151809 Length = 369 Score = 26.2 bits (55), Expect = 7.9 Identities = 21/72 (29%), Positives = 26/72 (36%), Gaps = 1/72 (1%) Frame = +2 Query: 14 VSERFTKMAKRTKKVG-ITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCV 190 + RF ++V K G Y L K AKYT G A RS Sbjct: 63 MKSRFEAFKANARQVNEFNKKEGMSYTLGLNKFSDMSYEEFAAKYTGGMPGSIADDRSSA 122 Query: 191 GIWSCKRCKRTV 226 G SCK ++ V Sbjct: 123 GAVSCKLREKNV 134 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,393,950 Number of Sequences: 37544 Number of extensions: 193914 Number of successful extensions: 520 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 566473892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -