BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0114 (665 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0946 - 26208253-26209075,26209181-26209329,26209525-26209812 29 3.3 01_01_0281 + 2327624-2327694,2327757-2327856 28 5.8 >06_03_0946 - 26208253-26209075,26209181-26209329,26209525-26209812 Length = 419 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 106 ASALPRWSRGTCARDIYKKKNIIP 177 A+A+PRW R C D++ KN+ P Sbjct: 370 AAAVPRWRRFCCDEDVWCIKNLNP 393 >01_01_0281 + 2327624-2327694,2327757-2327856 Length = 56 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 415 RLPRRNPALNYGHKSVWRISFRSSCPLRVHT 507 RL RR P+ Y K + S+R PLR H+ Sbjct: 12 RLCRRRPSAEYSWKPAAKHSWREDGPLRAHS 42 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,560,365 Number of Sequences: 37544 Number of extensions: 297587 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -