BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0110 (637 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 2.8 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 22 4.9 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 6.5 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.6 bits (46), Expect = 2.8 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +2 Query: 416 NCQHLAVYLNRQQGCPSNFNKIKIHN----SKYAFDSANADESDYWNDAHNRMFNSDVIG 583 N +HL YL+ G + N +K+ N + A N Y A + + I Sbjct: 68 NVRHLDEYLDVDAGTIAKLNALKVKNPNLKTLIAIGGWNEGSETYSQVAADAAKRATFIK 127 Query: 584 HSLNLI 601 +LNL+ Sbjct: 128 SALNLV 133 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 51 SFHCLALLGSASFPASC 1 S HC A+ GSA+ + C Sbjct: 332 SLHCAAVGGSANIMSGC 348 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 401 IGVTDNCQHLAVYLNRQQGCPSNFNKIKIHN 493 +G +HL L+ QG FN +K+ N Sbjct: 59 LGDDSRIKHLEPNLDVNQGNLKKFNALKLKN 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,338 Number of Sequences: 336 Number of extensions: 3225 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -