BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0107 (385 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 6.5 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 20 8.6 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 20 8.6 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 20 8.6 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.6 bits (41), Expect = 6.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 207 PPFVSPF*FQQEL 169 PP + PF FQ+ L Sbjct: 610 PPIIEPFTFQEGL 622 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 20.2 bits (40), Expect = 8.6 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 163 LVVMKPGESFKVFL*LMSWSVAGSLEAILYVPFLLCGVRCLIPR 32 L+VM SF + S VA + +L + + GVR +PR Sbjct: 254 LIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPR 297 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 20.2 bits (40), Expect = 8.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 30 LRGIKQRTPHSKKGTYKMASRDPATDQL 113 +RGI Q T +K Y M P D+L Sbjct: 17 VRGIDQDTVVAKYMEYLMPDIMPCADEL 44 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 20.2 bits (40), Expect = 8.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 30 LRGIKQRTPHSKKGTYKMASRDPATDQL 113 +RGI Q T +K Y M P D+L Sbjct: 17 VRGIDQDTVVAKYMEYLMPDIMPCADEL 44 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,883 Number of Sequences: 438 Number of extensions: 2399 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9424380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -