Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0106
         (597 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g04530.1 68417.m00660 Ulp1 protease family protein (snoR29) c...    28   5.4  

>At4g04530.1 68417.m00660 Ulp1 protease family protein (snoR29)
           contains Pfam profile PF02902: Ulp1 protease family,
           C-terminal catalytic domain; snoR29 gene for small
           nucleolar RNA GI:15706258
          Length = 917

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +3

Query: 246 DLWIATTD*IFTPVTESVSHDTDIVVGQFQVTLAV 350
           + W A  D ++TP+  +  H   IV+ Q + T+ V
Sbjct: 795 EAWFADVDILYTPLHLTAGHCVSIVINQKEGTIGV 829


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,071,953
Number of Sequences: 28952
Number of extensions: 202392
Number of successful extensions: 404
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 399
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 404
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1190791976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)